Domain assigned by cuff on 21 Jan 2009 10:47
homology match
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.630
| Aminopeptidase | |
3.40.630.10
| Zn peptidases | Gene3D |
3.40.630.10.12
| ||
3.40.630.10.12.1
| ||
3.40.630.10.12.1.1
| ||
3.40.630.10.12.1.1.1
| ||
3.40.630.10.12.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2rb7A01 | 0 | 173 |
| 2rb7A01 | 281 | 359 |
| 2rb7A02 | 174 | 280 |
There are 14 matching structural neighberhood comparisons for CATH ID 3.40.630.10.12.1.1.1.1 (SIMAX score < 5)
>pdb|2rb7A01 GSSQHIVELTSDLIRFPSHSRPEQISRCAGFIDWCAQNGIHAERDHDGIPSVVLPEKGRAGLLLAHIDVVDAEDDLFVPR VENDRLYGRGANDDKYAVALGLVFRDRLNALKAAGRSQKDALGLLITGDEEIGGNGAAKALPLIRADYVVALDGGNPQQV ITKEVFLAADSPYTERLLALSGATAGKAHGASDARYLGENGLTGVVWGAEGFNTLHSRDECLHIPSLQSIYDPLQLAREE E
homology match
same superfamily
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2rb7A01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rb7A01
Retrieved PRC_PFAMCATH results for job ID SID6845560575980832 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 79 results for 2rb7A01
PRC_PFAMCATH job SID6845560575980832 is not yet finished.
The entry "2rb7A01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2rb7A01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID1050077429924064 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 256 results for 2rb7A01
SSAP job SID1050077429924064 is not yet finished.
The entry "2rb7A01" has been submitted to the SSAP webservice.
The entry "2rb7A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID6787869562041872 because submission time of Tue Oct 28 12:13:02 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:32:59 2008).
SSAP job SID6787869562041872 is not yet finished.
The entry "2rb7A01" has been submitted to the SSAP webservice.
The entry "2rb7A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID8507132577306752 because submission time of Wed Oct 22 09:26:14 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:57:32 2008).
SSAP job SID8507132577306752 is not yet finished.
The entry "2rb7A01" has been submitted to the SSAP webservice.
The entry "2rb7A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4169320457962352 because submission time of Thu Oct 16 06:04:05 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:20:17 2008).
SSAP job SID4169320457962352 is not yet finished.
The entry "2rb7A01" has been submitted to the SSAP webservice.
The entry "2rb7A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4306384283330166 because submission time of Fri Oct 10 03:05:19 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:33:20 2008).
SSAP job SID4306384283330166 is not yet finished.
The entry "2rb7A01" has been submitted to the SSAP webservice.
The entry "2rb7A01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID4668683750289216 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 28 results for 2rb7A01
PRC job SID4668683750289216 is not yet finished.
The entry "2rb7A01" has been submitted to the PRC webservice.
The entry "2rb7A01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID5422839017097280 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2rb7A01
HMM(SAM) job SID5422839017097280 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID2721169389642880"
HMM(SAM) job SID2721169389642880 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID0852985409064766"
HMM(SAM) job SID0852985409064766 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID4459683997043404"
HMM(SAM) job SID4459683997043404 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID6504056800853888"
HMM(SAM) job SID6504056800853888 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID4357170112237454"
HMM(SAM) job SID4357170112237454 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID0752498304077984"
HMM(SAM) job SID0752498304077984 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID6980132633632304"
HMM(SAM) job SID6980132633632304 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID8313311826901440"
HMM(SAM) job SID8313311826901440 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID8722938140356784"
HMM(SAM) job SID8722938140356784 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID6830126158336544"
HMM(SAM) job SID6830126158336544 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID2222590884968768"
HMM(SAM) job SID2222590884968768 is not yet finished.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.
Retrieved "2rb7A01" CATHEDRAL results for job ID SID1470483340418976 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 507 results for 2rb7A01
"2rb7A01" CATHEDRAL job SID1470483340418976 is not yet finished.
The entry "2rb7A01" has been submitted to the CATHEDRAL webservice.
The entry "2rb7A01" has been submitted to the CATHEDRAL webservice.
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rb7A01.scanlist" for "2rb7A01"
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rb7A01.scanlist" for domain "2rb7A01"
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2rb7A01" ready to be processed
NW result present for Domain "2rb7A01"
All required files are present for Domain "2rb7A01"
Beginning processing for Domain "2rb7A01"
nice chopping