CATH Domain: 2rb7A01 XML data for domain: 2rb7A01

Molscript image for 2rb7A01
2rb7A01
PDB coordinates for domain 2rb7A01

PDB 2rb7, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.12
3.40.630.10.12.1
3.40.630.10.12.1.1
3.40.630.10.12.1.1.1
3.40.630.10.12.1.1.1.1

Segment boundaries for domain 2rb7A01

Chopping figure for domain 2rb7A01
DomainStart PDB ResidueStop PDB Residue
2rb7A01 0 173
2rb7A01 281 359
2rb7A02 174 280

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.40.630.10.12.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ct9B01 85.29 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 23 90 3.04 3.36
1vgyA01 84.11 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 20 87 2.80 3.21
2greA01 81.45 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 15 86 3.06 3.53
2qyvA01 81.34 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 19 86 3.64 4.21
1cg2A01 81.25 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 19 81 2.91 3.58
3cpxB01 79.49 Aminopeptidase, M42 familyCytophaga hutchinsonii ATCC 33406 3.40.630.10 243 14 82 3.37 4.07
2cf4A01 79.48 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 17 88 3.16 3.59
1vhoA01 78.76 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 3.40.630.10 237 12 86 3.46 4.02
1yloA01 78.69 Shigella flexneriPutative uncharacterized protein 3.40.630.10 254 14 82 3.58 4.33
1z2lB01 77.09 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 13 71 2.75 3.84
1xmbA01 76.33 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.40.630.10 274 12 78 3.76 4.77
3kasA01 75.24 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 12 67 3.25 4.79
2ijzA01 74.35 Aminopeptidase [EC:3.4.11.-]Pseudomonas aeruginosaProbable M18 family aminopeptidase 2 3.40.630.10 272 10 74 3.68 4.96
2v8hA01 74.18 Beta-alanine synthaseLachancea kluyveri 3.40.630.10 315 9 67 3.22 4.78
Displaying entries 1 to 14 (page 1 of 1)


Domain ATOM Sequence

>pdb|2rb7A01
GSSQHIVELTSDLIRFPSHSRPEQISRCAGFIDWCAQNGIHAERDHDGIPSVVLPEKGRAGLLLAHIDVVDAEDDLFVPR
VENDRLYGRGANDDKYAVALGLVFRDRLNALKAAGRSQKDALGLLITGDEEIGGNGAAKALPLIRADYVVALDGGNPQQV
ITKEVFLAADSPYTERLLALSGATAGKAHGASDARYLGENGLTGVVWGAEGFNTLHSRDECLHIPSLQSIYDPLQLAREE
E    

Domain COMBS Sequence

>pdb|2rb7A01
GXSSXQHIVELTSDLIRFPSXHSRPEQISRCAGFIXDWCAQNGIHAERXDHDGIPSVXVLPEKGRAGLLLXAHIDVVDAE
DDLFVPRVENDRLYGRGANDDKYAVALGLVXFRDRLNALKAAGRSQKDXALGLLITGDEEIGGXNGAAKALPLIRADYVV
ALDGGNPQQVITKEVFLAADSPYTERLLALSGATAGKAHGASDARYLGENGLTGVVWGAEGFNTLHSRDECLHIPSLQSI
YDPLXQLAREXEEHAAV    

Domain History Events (103)

Domain assigned by cuff on 21 Jan 2009 10:47

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 10:46

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 10:45

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 10:45

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 17:58

Domain "2rb7A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 17:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rb7A01

Flow stage update by auto on 05 Nov 2008 17:53

Retrieved PRC_PFAMCATH results for job ID SID6845560575980832 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 17:53

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 79 results for 2rb7A01

Update comment by auto on 05 Nov 2008 14:59

PRC_PFAMCATH job SID6845560575980832 is not yet finished.

Flow stage update by auto on 05 Nov 2008 14:55

The entry "2rb7A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 05 Nov 2008 14:55

The entry "2rb7A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 14:31

Retrieved SSAP results for job ID SID1050077429924064 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 14:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 256 results for 2rb7A01

Update comment by auto on 03 Nov 2008 17:48

SSAP job SID1050077429924064 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:36

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:36

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:32

Giving up on SSAP job SID6787869562041872 because submission time of Tue Oct 28 12:13:02 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:32:59 2008).

Update comment by auto on 28 Oct 2008 12:31

SSAP job SID6787869562041872 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:13

The entry "2rb7A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:13

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:57

Giving up on SSAP job SID8507132577306752 because submission time of Wed Oct 22 09:26:14 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:57:32 2008).

Update comment by auto on 22 Oct 2008 09:43

SSAP job SID8507132577306752 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:26

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:26

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:20

Giving up on SSAP job SID4169320457962352 because submission time of Thu Oct 16 06:04:05 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:20:17 2008).

Update comment by auto on 16 Oct 2008 06:21

SSAP job SID4169320457962352 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:04

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:04

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:33

Giving up on SSAP job SID4306384283330166 because submission time of Fri Oct 10 03:05:19 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:33:20 2008).

Update comment by auto on 10 Oct 2008 03:42

SSAP job SID4306384283330166 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:05

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:05

The entry "2rb7A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:43

Retrieved PRC results for job ID SID4668683750289216 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 28 results for 2rb7A01

Update comment by auto on 09 Oct 2008 03:59

PRC job SID4668683750289216 is not yet finished.

Prc cath submit by auto on 09 Oct 2008 03:38

The entry "2rb7A01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 03:38

The entry "2rb7A01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 03:27

Retrieved HMM(SAM) results for job ID SID5422839017097280 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 03:26

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2rb7A01

Update comment by auto on 05 Oct 2008 14:59

HMM(SAM) job SID5422839017097280 is not yet finished.

Flow stage update by auto on 05 Oct 2008 14:40

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Oct 2008 14:40

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 11:58

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID2721169389642880"

Update comment by auto on 03 Oct 2008 03:55

HMM(SAM) job SID2721169389642880 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 03:32

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 03:32

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:36

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID0852985409064766"

Update comment by auto on 02 Oct 2008 21:05

HMM(SAM) job SID0852985409064766 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:44

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:44

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:25

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID4459683997043404"

Update comment by auto on 02 Oct 2008 15:13

HMM(SAM) job SID4459683997043404 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:51

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:51

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:11

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID6504056800853888"

Update comment by auto on 02 Oct 2008 03:48

HMM(SAM) job SID6504056800853888 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:17

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:17

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 01 Oct 2008 21:04

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID4357170112237454"

Update comment by auto on 27 Sep 2008 12:26

HMM(SAM) job SID4357170112237454 is not yet finished.

Flow stage update by auto on 27 Sep 2008 12:18

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 27 Sep 2008 12:18

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Sep 2008 09:08

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID0752498304077984"

Update comment by auto on 26 Sep 2008 14:52

HMM(SAM) job SID0752498304077984 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 14:44

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:44

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 12:25

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID6980132633632304"

Update comment by auto on 26 Sep 2008 09:15

HMM(SAM) job SID6980132633632304 is not yet finished.

Flow stage update by auto on 26 Sep 2008 09:06

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 26 Sep 2008 09:06

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:37

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID8313311826901440"

Update comment by auto on 26 Sep 2008 03:49

HMM(SAM) job SID8313311826901440 is not yet finished.

Flow stage update by auto on 26 Sep 2008 03:38

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 26 Sep 2008 03:38

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 00:04

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID8722938140356784"

Update comment by auto on 25 Sep 2008 20:50

HMM(SAM) job SID8722938140356784 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 20:45

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 20:45

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 18:02

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID6830126158336544"

Update comment by auto on 25 Sep 2008 14:57

HMM(SAM) job SID6830126158336544 is not yet finished.

Flow stage update by auto on 25 Sep 2008 14:51

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 14:51

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:34

Unable to retrieve "2rb7A01" HMM(SAM) results for job "SID2222590884968768"

Update comment by auto on 25 Sep 2008 09:46

HMM(SAM) job SID2222590884968768 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 09:41

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:41

The entry "2rb7A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:34

Retrieved "2rb7A01" CATHEDRAL results for job ID SID1470483340418976 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 09:33

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 507 results for 2rb7A01

Update comment by auto on 25 Sep 2008 01:38

"2rb7A01" CATHEDRAL job SID1470483340418976 is not yet finished.

Cathedral cath submit by auto on 25 Sep 2008 00:08

The entry "2rb7A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 25 Sep 2008 00:08

The entry "2rb7A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:46

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rb7A01.scanlist" for "2rb7A01"

Write scan list by auto on 24 Sep 2008 23:46

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rb7A01.scanlist" for domain "2rb7A01"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 12:06

Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 08:51

Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.

Flow stage update by auto on 24 Sep 2008 08:49

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Sep 2008 08:23

No in_process hits for Domain "2rb7A01" ready to be processed

Flow stage update by auto on 24 Sep 2008 08:23

NW result present for Domain "2rb7A01"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2rb7A01"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2rb7A01"

Insertion by cuff on 22 Sep 2008 12:06

nice chopping