Domain assigned by cuff on 23 Mar 2009 16:35
homology match
CATH Domain: 2rauA00
2rauA00
PDB 2rau, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.1820
| Gene3D | |
 3.40.50.1820.16
| ||
 3.40.50.1820.16.1
| ||
 3.40.50.1820.16.1.1
| ||
 3.40.50.1820.16.1.1.1
| ||
 3.40.50.1820.16.1.1.1.1
|
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1820.16.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
3bwxA00 | 74.53 | 3.40.50.1820 | 275 | 12 | 71 | 3.48 | 4.84 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2rauA00 YEEWKIVKREAPILGNDQLIENIWKKREDSPYDIISLHKVNLIGGGNDAVLILPGTWSSGEQLVTISWNGVHYTIPDYRK SIVLYLARNGFNVYTIDYRTHYVPPFLKDRQLSFTANWGWSTWISDIKEVVSFIKRDSGQERIYLAGESFGGIAALNYSS LYWKNDIKGLILLDGGPTKHGIRFYTPEVNSIEEEAKGIYVIPSRGGPNNPIWSYALANPDPSPDPKYKSISDFLDSLYV TGSANPYDYPYSKKEDFPILASFDPYWPYRLSLERDLKFDYEGILVPTIAFVSERFGIQIFDSKILPSNSEIILLKGYGH LDVYTGENSEKDVNSVVLKWLSQQR
Domain COMBS Sequence
>pdb|2rauA00 GXYEEWKIVKREAPILGNDQLIENIWKXKREDSPYDIISLHKVNLIGGGNDAVLILPGTWSSGEQLVTISWNGVHYTIPD YRKSIVLYLARNGFNVYTIDYRTHYVPPFLKDRQLSFTANWGWSTWISDIKEVVSFIKRDSGQERIYLAGESFGGIAALN YSSLYWKNDIKGLILLDGGPTKHGIRPKFYTPEVNSIEEXEAKGIYVIPSRGGPNNPIWSYALANPDXPSPDPKYKSISD FLXDSLYVTGSANPYDYPYSKKEDXFPILASFDPYWPYRLSLERDLKFDYEGILVPTIAFVSERFGIQIFDSKILPSNSE IILLKGYGHLDVYTGENSEKDVNSVVLKWLSQQR
Domain History Events (69)
Domain assignment manual match h by cuff on 23 Mar 2009 16:33
same superfamily
Homcheck allotment by cuff on 23 Mar 2009 16:27
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 23 Mar 2009 16:27
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 19 Mar 2009 17:31
Domain "2rauA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 19 Mar 2009 17:30
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2rauA00
Flow stage update by auto on 19 Mar 2009 14:22
Retrieved PRC_PFAMCATH results for job ID SID2213602634920308 and results inserted.
Domain scan prc pfamcath by auto on 19 Mar 2009 14:21
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2130 results for 2rauA00
Update comment by auto on 07 Mar 2009 12:33
PRC_PFAMCATH job SID2213602634920308 is not yet finished.
Flow stage update by auto on 07 Mar 2009 12:30
The entry "2rauA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 07 Mar 2009 12:30
The entry "2rauA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 07 Mar 2009 12:21
Retrieved SSAP results for job ID SID8412031314896656 and results inserted.
Domain scan ssap cath by auto on 07 Mar 2009 12:19
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 238 results for 2rauA00
Update comment by auto on 04 Mar 2009 09:12
SSAP job SID8412031314896656 is not yet finished.
Ssap cath submit by auto on 04 Mar 2009 08:51
The entry "2rauA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 08:51
The entry "2rauA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 06:53
Retrieved PRC results for job ID SID4219779804097744 and inserted them into the database.
Domain scan prc cath by auto on 04 Mar 2009 06:52
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 90 results for 2rauA00
Update comment by auto on 04 Mar 2009 01:49
PRC job SID4219779804097744 is not yet finished.
Prc cath submit by auto on 04 Mar 2009 01:42
The entry "2rauA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 01:42
The entry "2rauA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 00:52
Retrieved HMM(SAM) results for job ID SID0440913977547856 and inserted them into the database.
Domain scan sam cath by auto on 04 Mar 2009 00:51
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 51 results for 2rauA00
Sam cath submit by auto on 03 Mar 2009 23:31
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Mar 2009 23:31
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 15:52
Unable to retrieve "2rauA00" HMM(SAM) results for job "SID7730550463410464"
Update comment by auto on 19 Feb 2009 08:33
HMM(SAM) job SID7730550463410464 is not yet finished.
Sam cath submit by auto on 19 Feb 2009 08:04
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 08:04
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Jan 2009 12:16
Unable to retrieve "2rauA00" HMM(SAM) results for job "SID4313070141672624"
Update comment by auto on 22 Jan 2009 17:44
HMM(SAM) job SID4313070141672624 is not yet finished.
Flow stage update by auto on 22 Jan 2009 17:25
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 22 Jan 2009 17:25
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 15:01
Unable to retrieve "2rauA00" HMM(SAM) results for job "SID0829419746022272"
Update comment by auto on 03 Dec 2008 11:02
HMM(SAM) job SID0829419746022272 is not yet finished.
Sam cath submit by auto on 03 Dec 2008 10:49
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 10:49
The entry "2rauA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 09:00
Retrieved "2rauA00" CATHEDRAL results for job ID SID7240003279988684 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Dec 2008 08:56
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 466 results for 2rauA00
Update comment by auto on 03 Dec 2008 00:40
"2rauA00" CATHEDRAL job SID7240003279988684 is not yet finished.
Cathedral cath submit by auto on 03 Dec 2008 00:11
The entry "2rauA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 00:11
The entry "2rauA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 02 Dec 2008 23:33
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rauA00.scanlist" for "2rauA00"
Write scan list by auto on 02 Dec 2008 23:33
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2rauA00.scanlist" for domain "2rauA00"
Update comment by auto on 02 Dec 2008 21:06
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 17:27
Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 15:14
Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 11:26
Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 10:46
Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 23:27
Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 21:05
Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 18:09
Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 14:30
Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 11:55
Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 08:56
Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 06:13
Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 03:58
Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 23:34
Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 22:03
Waiting for 476 new domains (example : 3c3jA02) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 17:39
Waiting for 527 new domains (example : 3brcB02) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 15:29
Waiting for 591 new domains (example : 3b9hA00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 09:19
Waiting for 626 new domains (example : 2zddA02) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 05:50
Waiting for 679 new domains (example : 2ve5A02) to be processed so that they can be scanned against too.
Flow stage update by auto on 30 Nov 2008 03:39
No satisfactory AssignClose result found.
Flow stage update by auto on 30 Nov 2008 02:43
No in_process hits for Domain "2rauA00" ready to be processed
Flow stage update by auto on 30 Nov 2008 02:43
NW result present for Domain "2rauA00"
Flow stage update by auto on 28 Nov 2008 11:13
All required files are present for Domain "2rauA00"
Flow stage update by auto on 27 Nov 2008 20:08
Beginning processing for Domain "2rauA00"
Insertion by cuff on 27 Nov 2008 16:43
nice chopping
