CATH Domain: 2raaA00 XML data for domain: 2raaA00

Molscript image for 2raaA00
2raaA00
PDB coordinates for domain 2raaA00

PDB 2raa, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.920 Pyruvate-ferredoxin Oxidoreductase; domain 3
3.40.920.10 Pyruvate-ferredoxin Oxidoreductase; domain 3 Gene3D
3.40.920.10.2
3.40.920.10.2.1
3.40.920.10.2.1.1
3.40.920.10.2.1.1.1
3.40.920.10.2.1.1.1.1

[top]
Segment boundaries for domain 2raaA00

Chopping figure for domain 2raaA00
DomainStart PDB ResidueStop PDB Residue
2raaA00 5 192

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2raaA00
KKYFEIRWHGRAGQGAKSASQLAEAALEAGKYVQAFPEYGARTGAPRAFNRIGDEAVENPDVVVVIDETLLSPAIVEGLS
EDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPLGALVRVTGIVPLEAIEKRIEKFFPQEVIDANK
RALRRGYEEVKCSE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2raaA00
KKYFEIRWHGRAGQGAKSASQXLAEAALEAGKYVQAFPEYGAERTGAPXRAFNRIGDEYIRVRSAVENPDVVVVIDETLL
SPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPXLGALVRVTGIVPLEAIEKRIEKX
FGKKFPQEVIDANKRALRRGYEEVKCSE
BLAST against CATH

[top]
Domain History Events (103)

Domain assigned by cuff on 22 Jan 2009 10:36

same superfamily

Domain assignment manual match h by cuff on 20 Jan 2009 18:33

same superfamily

Homcheck allotment by cuff on 20 Jan 2009 18:30

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 20 Jan 2009 18:30

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 17:58

Domain "2raaA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 17:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2raaA00

Flow stage update by auto on 05 Nov 2008 17:53

Retrieved PRC_PFAMCATH results for job ID SID7533307726851488 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 17:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2raaA00

Update comment by auto on 05 Nov 2008 14:58

PRC_PFAMCATH job SID7533307726851488 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 14:54

The entry "2raaA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 14:54

The entry "2raaA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 14:31

Retrieved SSAP results for job ID SID2268678316822464 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 14:27

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1668 results for 2raaA00

Update comment by auto on 03 Nov 2008 17:48

SSAP job SID2268678316822464 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:35

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:35

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:32

Giving up on SSAP job SID2231673288132064 because submission time of Tue Oct 28 12:12:38 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:32:42 2008).

Update comment by auto on 28 Oct 2008 12:31

SSAP job SID2231673288132064 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:12

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:12

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:57

Giving up on SSAP job SID0548509634568707 because submission time of Wed Oct 22 09:25:48 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:57:15 2008).

Update comment by auto on 22 Oct 2008 09:42

SSAP job SID0548509634568707 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:25

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:25

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:19

Giving up on SSAP job SID7060519612705968 because submission time of Thu Oct 16 06:03:41 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:19:53 2008).

Update comment by auto on 16 Oct 2008 06:21

SSAP job SID7060519612705968 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:03

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:03

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:32

Giving up on SSAP job SID9775498657260408 because submission time of Fri Oct 10 03:04:41 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:32:52 2008).

Update comment by auto on 10 Oct 2008 03:41

SSAP job SID9775498657260408 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:04

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:04

The entry "2raaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:39

Retrieved PRC results for job ID SID9674262832788528 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:38

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2raaA00

Update comment by auto on 08 Oct 2008 18:22

PRC job SID9674262832788528 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 18:09

The entry "2raaA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 18:09

The entry "2raaA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 17:49

Retrieved HMM(SAM) results for job ID SID5254768042471668 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 17:48

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2raaA00

Update comment by auto on 03 Oct 2008 21:03

HMM(SAM) job SID5254768042471668 is not yet finished.

Flow stage update by auto on 03 Oct 2008 20:44

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 20:44

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 18:02

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID0050482908584272"

Update comment by auto on 03 Oct 2008 00:36

HMM(SAM) job SID0050482908584272 is not yet finished.

Flow stage update by auto on 03 Oct 2008 00:11

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 00:11

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 21:05

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID1973817705208864"

Update comment by auto on 02 Oct 2008 18:25

HMM(SAM) job SID1973817705208864 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 18:07

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:07

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 15:12

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID3309320901740864"

Update comment by auto on 02 Oct 2008 12:10

HMM(SAM) job SID3309320901740864 is not yet finished.

Flow stage update by auto on 02 Oct 2008 11:53

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 11:53

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 09:31

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID2477450445933066"

Update comment by auto on 01 Oct 2008 06:15

HMM(SAM) job SID2477450445933066 is not yet finished.

Flow stage update by auto on 01 Oct 2008 06:09

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 01 Oct 2008 06:08

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 01 Oct 2008 03:18

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID9697970984107200"

Update comment by auto on 26 Sep 2008 17:53

HMM(SAM) job SID9697970984107200 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 17:46

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 17:46

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:52

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID0547243112592496"

Update comment by auto on 26 Sep 2008 12:25

HMM(SAM) job SID0547243112592496 is not yet finished.

Flow stage update by auto on 26 Sep 2008 12:16

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 26 Sep 2008 12:16

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 09:15

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID3039508785848416"

Update comment by auto on 26 Sep 2008 06:37

HMM(SAM) job SID3039508785848416 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 06:28

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:28

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 03:49

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID5464035722015104"

Update comment by auto on 26 Sep 2008 00:04

HMM(SAM) job SID5464035722015104 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 23:54

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 23:54

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 20:50

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID1029639406717120"

Update comment by auto on 25 Sep 2008 18:02

HMM(SAM) job SID1029639406717120 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 17:52

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 17:52

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 14:57

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID9314498663412864"

Update comment by auto on 25 Sep 2008 12:34

HMM(SAM) job SID9314498663412864 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 12:22

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:22

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:46

Unable to retrieve "2raaA00" HMM(SAM) results for job "SID7592853564160744"

Update comment by auto on 25 Sep 2008 02:51

HMM(SAM) job SID7592853564160744 is not yet finished.

Flow stage update by auto on 25 Sep 2008 02:39

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 02:39

The entry "2raaA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 01:36

Retrieved "2raaA00" CATHEDRAL results for job ID SID7299229446016752 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 01:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 478 results for 2raaA00

Cathedral cath submit by auto on 25 Sep 2008 00:08

The entry "2raaA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 25 Sep 2008 00:08

The entry "2raaA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:46

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2raaA00.scanlist" for "2raaA00"

Write scan list by auto on 24 Sep 2008 23:46

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2raaA00.scanlist" for domain "2raaA00"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 12:06

Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 08:51

Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 07:12

Waiting for 252 new domains (example : 2raeA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 24 Sep 2008 03:20

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Sep 2008 02:33

No in_process hits for Domain "2raaA00" ready to be processed

Flow stage update by auto on 24 Sep 2008 02:33

NW result present for Domain "2raaA00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2raaA00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2raaA00"

Insertion by cuff on 22 Sep 2008 13:19

nice chopping