Domain assigned by cuff on 19 Jan 2009 12:46
same superfamily
CATH Domain: 2ra8A02
2ra8A02
PDB 2ra8, Chain A, Domain 2
Segment boundaries for domain 2ra8A02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2ra8A01 | 2 | 75 |
| 2ra8A02 | 77 | 357 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2ra8A02 KVEAKKYALSYDEAEEGVNLDKILKDKKLPSLKQITIGWGYEGEDCSDIADGIVENKEKFAHFEGLFWGDIDFEEQEISW IEQVDLSPVLDAPLLNNLKIKGTNNLSIGKKPRPNLKSLEIISGGLPDSVVEDILGSDLPNLEKLVLYVGVEDYGFDGDN VFRPLFSKDRFPNLKWLGIVDAEEQNVVVEFLESDILPQLETDISAGVLTDEGARLLLDHVDKIKHLKFINKYNYLSDEK KELQKSLPKIDVSDSQEYPITELEH
Domain COMBS Sequence
>pdb|2ra8A02 KVEAKKYALSYDEAEEGVNLXDKILKDKKLPSLKQITIGXWGYEGEDCSDIADGIVENKEKFAHFEGLFWGDIDFEEQEI SWIEQVDLSPVLDAXPLLNNLKIKGTNNLSIGKKPRPNLKSLEIISGGLPDSVVEDILGSDLPNLEKLVLYVGVEDYGFD GDXNVFRPLFSKDRFPNLKWLGIVDAEEQNVVVEXFLESDILPQLETXDISAGVLTDEGARLLLDHVDKIKHLKFINXKY NYLSDEXKKELQKSLPXKIDVSDSQEYDDDYSYPXITELEHHHHHH
Domain History Events (57)
Domain assignment manual match h by cuff on 19 Jan 2009 12:43
same superfamily
Homcheck allotment by cuff on 19 Jan 2009 11:41
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 19 Jan 2009 11:41
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 05 Nov 2008 20:56
Domain "2ra8A02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 05 Nov 2008 20:56
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ra8A02
Flow stage update by auto on 05 Nov 2008 20:52
Retrieved PRC_PFAMCATH results for job ID SID8617261265648864 and results inserted.
Domain scan prc pfamcath by auto on 05 Nov 2008 20:51
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 7 results for 2ra8A02
Update comment by auto on 05 Nov 2008 17:52
PRC_PFAMCATH job SID8617261265648864 is not yet finished.
Flow stage update by auto on 05 Nov 2008 17:51
The entry "2ra8A02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 05 Nov 2008 17:50
The entry "2ra8A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 05 Nov 2008 17:32
Retrieved SSAP results for job ID SID4172865691238560 and results inserted.
Domain scan ssap cath by auto on 05 Nov 2008 17:31
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 75 results for 2ra8A02
Update comment by auto on 03 Nov 2008 17:47
SSAP job SID4172865691238560 is not yet finished.
Flow stage update by auto on 03 Nov 2008 17:35
The entry "2ra8A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 03 Nov 2008 17:35
The entry "2ra8A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 14:32
Giving up on SSAP job SID3411081416017203 because submission time of Tue Oct 28 12:12:05 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:32:22 2008).
Update comment by auto on 28 Oct 2008 12:31
SSAP job SID3411081416017203 is not yet finished.
Flow stage update by auto on 28 Oct 2008 12:12
The entry "2ra8A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 28 Oct 2008 12:12
The entry "2ra8A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 08:56
Giving up on SSAP job SID7715452882602552 because submission time of Wed Oct 22 09:25:07 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:56:53 2008).
Update comment by auto on 22 Oct 2008 09:42
SSAP job SID7715452882602552 is not yet finished.
Flow stage update by auto on 22 Oct 2008 09:25
The entry "2ra8A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 22 Oct 2008 09:25
The entry "2ra8A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:19
Giving up on SSAP job SID5831240010175838 because submission time of Thu Oct 16 03:10:24 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:19:23 2008).
Update comment by auto on 16 Oct 2008 03:32
SSAP job SID5831240010175838 is not yet finished.
Flow stage update by auto on 16 Oct 2008 03:10
The entry "2ra8A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 16 Oct 2008 03:10
The entry "2ra8A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:07
Retrieved PRC results for job ID SID6687528810166696 and inserted them into the database.
Domain scan prc cath by auto on 16 Oct 2008 03:06
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 22 results for 2ra8A02
Update comment by auto on 15 Oct 2008 23:41
PRC job SID6687528810166696 is not yet finished.
Prc cath submit by auto on 15 Oct 2008 23:38
The entry "2ra8A02" has been submitted to the PRC webservice.
Flow stage update by auto on 15 Oct 2008 23:38
The entry "2ra8A02" has been submitted to the PRC webservice.
Flow stage update by auto on 15 Oct 2008 23:32
Retrieved HMM(SAM) results for job ID SID7063616696229572 and inserted them into the database.
Domain scan sam cath by auto on 15 Oct 2008 23:31
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2ra8A02
Update comment by auto on 15 Oct 2008 11:31
HMM(SAM) job SID7063616696229572 is not yet finished.
Flow stage update by auto on 15 Oct 2008 11:30
The entry "2ra8A02" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 15 Oct 2008 11:30
The entry "2ra8A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 15 Oct 2008 11:27
Retrieved "2ra8A02" CATHEDRAL results for job ID SID7004525404802752 and inserted them into the database.
Domain scan cathedral cath by auto on 15 Oct 2008 11:26
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 494 results for 2ra8A02
Update comment by auto on 13 Oct 2008 17:57
"2ra8A02" CATHEDRAL job SID7004525404802752 is not yet finished.
Cathedral cath submit by auto on 13 Oct 2008 17:55
The entry "2ra8A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 13 Oct 2008 17:55
The entry "2ra8A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 13 Oct 2008 17:51
ScanList with 12158 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ra8A02.scanlist" for "2ra8A02"
Write scan list by auto on 13 Oct 2008 17:51
Writing ScanList containing 12158 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ra8A02.scanlist" for domain "2ra8A02"
Update comment by auto on 13 Oct 2008 14:39
Waiting for 7 new domains (example : 3emjH00) to be processed so that they can be scanned against too.
Update comment by auto on 13 Oct 2008 10:34
Waiting for 105 new domains (example : 3d5d600) to be processed so that they can be scanned against too.
Update comment by auto on 13 Oct 2008 06:03
Waiting for 143 new domains (example : 3d5aS00) to be processed so that they can be scanned against too.
Update comment by auto on 13 Oct 2008 03:39
Waiting for 192 new domains (example : 3cksA00) to be processed so that they can be scanned against too.
Update comment by auto on 12 Oct 2008 21:33
Waiting for 233 new domains (example : 3b7kC01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Oct 2008 18:26
Waiting for 276 new domains (example : 2v4iD02) to be processed so that they can be scanned against too.
Flow stage update by auto on 12 Oct 2008 17:40
No satisfactory AssignClose result found.
Flow stage update by auto on 12 Oct 2008 17:17
No in_process hits for Domain "2ra8A02" ready to be processed
Flow stage update by auto on 12 Oct 2008 17:17
NW result present for Domain "2ra8A02"
Flow stage update by auto on 11 Oct 2008 08:41
All required files are present for Domain "2ra8A02"
Flow stage update by auto on 10 Oct 2008 17:39
Beginning processing for Domain "2ra8A02"
Insertion by cuff on 10 Oct 2008 15:18
nice chopping
