CATH Domain: 2ra2B00 XML data for domain: 2ra2B00

Molscript image for 2ra2B00
2ra2B00
PDB coordinates for domain 2ra2B00

PDB 2ra2, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.100 Gene3D
2.30.30.100.8
2.30.30.100.8.1
2.30.30.100.8.1.1
2.30.30.100.8.1.1.1
2.30.30.100.8.1.1.1.1

[top]
Segment boundaries for domain 2ra2B00

Chopping figure for domain 2ra2B00
DomainStart PDB ResidueStop PDB Residue
2ra2B00 2 59

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.30.30.100.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2k57A00 89.98 Pseudomonas syringae pv. phaseolicola 1448ALipoprotein, putative 2.30.30.100 55 27 94 1.70 1.80
1biaA03 80.71 Biotin metabolismDNA bindingBirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]Bifunctional protein birABiotin-[acetyl-CoA-carboxylase] ligase activity 2.30.30.100 47 6 83 2.87 3.43
1sf9A02 80.18 Bacillus subtilisUncharacterized protein yfhH 2.30.30.340 54 5 81 3.87 4.73
3by7E00 78.86 2.30.30.100 74 12 67 3.34 4.94
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ra2B00
SGPNYVHTNDGRSIVTDGKPQTDNDTGISYKDANGNKQQINRTDVKEVALENLEH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ra2B00
XSGPNYVXHTNDGRSIVTDGKPQTDNDTGXISYKDANGNKQQINRTDVKEXVALENLEHHHHHH
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 21 Feb 2008 14:38

Assigning to "2.30.30.100" based on similarity with "2ra2A00"

Flow stage update by auto on 21 Feb 2008 14:38

No in_process hits for Domain "2ra2B00" ready to be processed

Update comment by auto on 21 Feb 2008 14:23

Domain "2ra2B00" hits Domain "2ra2A00" (93.75% over 100%) which is currently in process

Update comment by auto on 30 Nov 2007 05:36

Domain "2ra2B00" hits Domain "2jn0A00" (59.0163934426229% over 95.3125%) which is currently in process

Flow stage update by auto on 30 Nov 2007 05:17

Domain "2ra2B00" hits Domain "2jn0A00" (59.0163934426229% over 95.3125%) which is currently in process

Flow stage update by auto on 30 Nov 2007 05:16

NW result present for Domain "2ra2B00"

Flow stage update by auto on 24 Nov 2007 14:39

All required files are present for Domain "2ra2B00"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2ra2B00"

Insertion by auto on 23 Nov 2007 18:30

Final ChopClose added based on similarity with "2ra2A"