CATH Domain: 2r9qC01 XML data for domain: 2r9qC01

Molscript image for 2r9qC01
2r9qC01
PDB coordinates for domain 2r9qC01

PDB 2r9q, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.70 Distorted Sandwich
2.70.40 Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A
2.70.40.10 Gene3D
2.70.40.10.8
2.70.40.10.8.1
2.70.40.10.8.1.1
2.70.40.10.8.1.1.1
2.70.40.10.8.1.1.1.1

[top]
Segment boundaries for domain 2r9qC01

Chopping figure for domain 2r9qC01
DomainStart PDB ResidueStop PDB Residue
2r9qC01 9 173
2r9qC02 174 346

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.70.40.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2okbA00 78.20 Vaccinia virusDUTP pyrophosphatase 2.70.40.10 113 15 63 2.16 3.42
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r9qC01
RTTGILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMPGPGTRVIDKLNRLHEVDLSQGAVLETG
CVYIVPLMESLALPADMSASANPKSSTGRLDIFTRVMTDNAQEFDKIPAGYTGPLYLEISPRTFPIVVRRGSRLSQIRFR
IGH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r9qC01
MTRTTGTRTTGILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMPGPGTRVIDKLNRFSLHEVDL
SQGAVLETGCVYIVPLMESLALPADMSASANPKSSTGRLDIFTRVMTDNAQEFDKIPAGYTGPLYLEISPRTFPIVVRRG
SRLSQIRFRIGH
BLAST against CATH

[top]
Domain History Events (95)

Domain assigned by cuff on 22 Jan 2009 10:37

homology match

Domain assignment manual match h by cuff on 19 Jan 2009 11:21

homology match

Homcheck allotment by cuff on 19 Jan 2009 11:18

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 19 Jan 2009 11:18

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 06:07

Domain "2r9qC01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 06:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r9qC01

Flow stage update by auto on 05 Nov 2008 06:01

Retrieved PRC_PFAMCATH results for job ID SID6920579827182208 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 06:00

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 18 results for 2r9qC01

Update comment by auto on 05 Nov 2008 04:44

PRC_PFAMCATH job SID6920579827182208 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 04:37

The entry "2r9qC01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 04:37

The entry "2r9qC01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 03:37

Retrieved SSAP results for job ID SID1872255809501922 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 03:35

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 482 results for 2r9qC01

Update comment by auto on 03 Nov 2008 17:47

SSAP job SID1872255809501922 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:35

The entry "2r9qC01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:35

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:32

Giving up on SSAP job SID0987258136274200 because submission time of Tue Oct 28 12:11:42 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:32:06 2008).

Update comment by auto on 28 Oct 2008 12:30

SSAP job SID0987258136274200 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:11

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:11

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:56

Giving up on SSAP job SID3017279854954240 because submission time of Wed Oct 22 09:24:37 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:56:36 2008).

Update comment by auto on 22 Oct 2008 09:42

SSAP job SID3017279854954240 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:24

The entry "2r9qC01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:24

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:19

Giving up on SSAP job SID4494713975968800 because submission time of Thu Oct 16 06:03:00 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:19:06 2008).

Update comment by auto on 16 Oct 2008 06:20

SSAP job SID4494713975968800 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:03

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:03

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:31

Giving up on SSAP job SID8195923329415348 because submission time of Fri Oct 10 03:03:22 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:31:40 2008).

Update comment by auto on 10 Oct 2008 03:40

SSAP job SID8195923329415348 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:03

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:03

The entry "2r9qC01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:34

Retrieved PRC results for job ID SID8648027765411296 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:33

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2r9qC01

Update comment by auto on 09 Oct 2008 03:58

PRC job SID8648027765411296 is not yet finished.

Flow stage update by auto on 09 Oct 2008 03:37

The entry "2r9qC01" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Oct 2008 03:37

The entry "2r9qC01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 03:26

Retrieved HMM(SAM) results for job ID SID8940784610785708 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 03:25

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2r9qC01

Update comment by auto on 05 Oct 2008 11:57

HMM(SAM) job SID8940784610785708 is not yet finished.

Flow stage update by auto on 05 Oct 2008 11:41

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Oct 2008 11:41

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 08:50

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID7298320679656084"

Update comment by auto on 03 Oct 2008 03:54

HMM(SAM) job SID7298320679656084 is not yet finished.

Flow stage update by auto on 03 Oct 2008 03:31

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 03:31

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:35

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID5754682081307103"

Update comment by auto on 02 Oct 2008 21:04

HMM(SAM) job SID5754682081307103 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:44

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:44

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:24

Giving up on HMM(SAM) job SID4461760980267440 because submission time of Fri Sep 26 17:45:58 2008 is more than 518400 seconds older than current time (Thu Oct 2 18:24:56 2008).

Update comment by auto on 26 Sep 2008 17:52

HMM(SAM) job SID4461760980267440 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 17:45

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 17:45

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:51

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID7329327788542224"

Update comment by auto on 26 Sep 2008 12:24

HMM(SAM) job SID7329327788542224 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 12:15

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 12:15

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 09:14

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID4795619165131016"

Update comment by auto on 26 Sep 2008 06:36

HMM(SAM) job SID4795619165131016 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 06:27

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:27

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 03:48

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID5501664814493504"

Update comment by auto on 26 Sep 2008 00:03

HMM(SAM) job SID5501664814493504 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 23:53

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 23:53

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 20:50

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID5246823335155232"

Update comment by auto on 25 Sep 2008 18:01

HMM(SAM) job SID5246823335155232 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 17:51

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 17:51

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 14:56

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID6202559617980512"

Update comment by auto on 25 Sep 2008 12:33

HMM(SAM) job SID6202559617980512 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 12:21

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:21

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:45

Unable to retrieve "2r9qC01" HMM(SAM) results for job "SID0554938926323224"

Update comment by auto on 25 Sep 2008 02:50

HMM(SAM) job SID0554938926323224 is not yet finished.

Flow stage update by auto on 25 Sep 2008 02:38

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 02:38

The entry "2r9qC01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 01:27

Retrieved "2r9qC01" CATHEDRAL results for job ID SID9760210429640336 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 01:26

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 310 results for 2r9qC01

Flow stage update by auto on 25 Sep 2008 00:07

The entry "2r9qC01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 25 Sep 2008 00:07

The entry "2r9qC01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:44

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2r9qC01.scanlist" for "2r9qC01"

Write scan list by auto on 24 Sep 2008 23:44

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2r9qC01.scanlist" for domain "2r9qC01"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 12:06

Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 08:51

Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 07:12

Waiting for 252 new domains (example : 2raeA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 24 Sep 2008 03:20

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Sep 2008 02:33

No in_process hits for Domain "2r9qC01" ready to be processed

Flow stage update by auto on 24 Sep 2008 02:33

NW result present for Domain "2r9qC01"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r9qC01"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r9qC01"

Insertion by cuff on 22 Sep 2008 12:25

nice chopping