CATH Domain: 2r9qA02 XML data for domain: 2r9qA02

Molscript image for 2r9qA02
2r9qA02
PDB coordinates for domain 2r9qA02

PDB 2r9q, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.70 Distorted Sandwich
2.70.40 Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A
2.70.40.10 Gene3D
2.70.40.10.7
2.70.40.10.7.1
2.70.40.10.7.1.1
2.70.40.10.7.1.1.1
2.70.40.10.7.1.1.1.1

[top]
Segment boundaries for domain 2r9qA02

Chopping figure for domain 2r9qA02
DomainStart PDB ResidueStop PDB Residue
2r9qA01 9 173
2r9qA02 174 346

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.70.40.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xs1A00 82.24 Pyrimidine metabolismMetabolic pathwaysDCTP deaminase activityDCTP deaminase [EC:3.5.4.13]Deoxycytidine triphosphate deaminase 2.70.40.10 193 17 77 1.87 2.41
2okbA00 77.87 Vaccinia virusDUTP pyrophosphatase 2.70.40.10 113 12 60 2.47 4.07
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r9qA02
ALLNESEVLKLHETETLVAPNVTGIALSIDLKGFGENGLIGYRGKHHTAVVDVDKKAQHDVLDFWEPLFARGRAELILDP
DEFYILVSREAVHVPPLYAAEMTPFDPLVGEFRVHYAGFFDPGFGHTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHMLE
KPE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r9qA02
ALLNESEVLKLHETETLVASENPNVTGGGIALSIDLKGFGENGLIGYRGKHHTAVVDVDKKAQHDVLDFWEPLFARGRAE
LILDPDEFYILVSREAVHVPPLYAAEMTPFDPLVGEFRVHYAGFFDPGFGHAQAGGTGSRAVLEVRSHEVPFILEHGQIV
GRLVYEHMLEKPE
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 19 Jan 2009 12:10

Assigning to "2.70.40.10" based on similarity with "2r9qC02"

Flow stage update by auto on 19 Jan 2009 12:08

No in_process hits for Domain "2r9qA02" ready to be processed

Update comment by auto on 19 Jan 2009 12:01

Domain "2r9qA02" hits Domain "2r9qB02" (100% over 95.5801104972376%) which is currently in process

Update comment by auto on 19 Jan 2009 11:45

Domain "2r9qA02" hits Domain "2r9qD02" (100% over 97.6878612716763%) which is currently in process

Update comment by auto on 12 Dec 2008 20:38

Domain "2r9qA02" hits Domain "2r9qC02" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:36

Domain "2r9qA02" hits Domain "2r9qC02" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:35

NW result present for Domain "2r9qA02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2r9qA02"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2r9qA02"

Insertion by auto on 08 Dec 2008 15:32

Final ChopClose added based on similarity with "2r9qC"