CATH Domain: 2r8oB03 XML data for domain: 2r8oB03

Molscript image for 2r8oB03
2r8oB03
PDB coordinates for domain 2r8oB03

PDB 2r8o, Chain B, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.920 Gene3D
3.40.50.920.1
3.40.50.920.1.1
3.40.50.920.1.1.1
3.40.50.920.1.1.1.1
3.40.50.920.1.1.1.1.1

[top]
Segment boundaries for domain 2r8oB03

Chopping figure for domain 2r8oB03
DomainStart PDB ResidueStop PDB Residue
2r8oB01 2 326
2r8oB02 327 537
2r8oB03 538 668

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.50.920.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3l84A03 91.76 TransketolasePentose phosphate pathwayCampylobacter jejuniTransketolase [EC:2.2.1.1]Metabolic pathways 3.40.50.920 116 35 88 1.42 1.60
2ozlB02 84.65 Pyruvate dehydrogenase (acetyl-transferring) activityPyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]Citrate cycle (TCA cycle)Pyruvate dehydrogenase E1 component subunit beta, mitochondrialTricarboxylic acid cycle 3.40.50.920 134 14 88 2.81 3.19
2bfdB02 84.05 Mitochondrial alpha-ketoglutarate dehydrogenase complexCarboxy-lyase activityValine, leucine and isoleucine degradationBranched chain family amino acid catabolic processMetabolic pathways 3.40.50.920 125 7 83 2.56 3.05
1l8aA03 80.96 Citrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine biosynthesisMetabolic pathwaysButanoate metabolism 3.40.50.920 181 22 71 3.13 4.39
2pjuC01 78.44 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.2300 100 8 74 3.36 4.54
2q5cA01 73.38 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.2300 97 13 72 3.56 4.91
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r8oB03
RGGYVLKDCAGQPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQDAAYRESVLPKAVTARVAVEAGIAD
YWYKYVGLNGAIVGMTTFGESAPAELLFEEFGFTVDNVVAKAKELLHHHHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r8oB03
RGGYVLKDCAGQPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQDAAYRESVLPKAVTARVAVEAGIAD
YWYKYVGLNGAIVGMTTFGESAPAELLFEEFGFTVDNVVAKAKELLHHHHHH
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 15 Dec 2007 18:16

Assigning to "3.40.50.920" based on similarity with "2r8pA03"

Flow stage update by auto on 15 Dec 2007 18:16

No in_process hits for Domain "2r8oB03" ready to be processed

Update comment by auto on 15 Dec 2007 18:12

Domain "2r8oB03" hits Domain "2r8oA03" (100% over 100%) which is currently in process

Update comment by auto on 15 Dec 2007 14:29

Domain "2r8oB03" hits Domain "2r8pA03" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Dec 2007 14:08

Domain "2r8oB03" hits Domain "2r8pA03" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Dec 2007 14:08

NW result present for Domain "2r8oB03"

Flow stage update by auto on 15 Dec 2007 10:05

All required files are present for Domain "2r8oB03"

Flow stage update by auto on 14 Dec 2007 14:31

Beginning processing for Domain "2r8oB03"

Insertion by auto on 14 Dec 2007 14:10

Final ChopClose added based on similarity with "2r5nA"