CATH Domain: 2r8cA01 XML data for domain: 2r8cA01

Molscript image for 2r8cA01
2r8cA01
PDB coordinates for domain 2r8cA01

PDB 2r8c, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.19
2.30.40.10.19.2
2.30.40.10.19.2.1
2.30.40.10.19.2.1.1
2.30.40.10.19.2.1.1.1

[top]
Segment boundaries for domain 2r8cA01

Chopping figure for domain 2r8cA01
DomainStart PDB ResidueStop PDB Residue
2r8cA01 2 58
2r8cA01 365 414
2r8cA02 59 364

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.30.40.10.19.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkrA01 85.48 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 20 77 1.91 2.48
1o12A01 83.85 Amino sugar and nucleotide sugar metabolismThermotoga maritimaN-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 72 27 68 3.23 4.71
2oodA01 80.43 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 15 71 2.58 3.63
2imrA01 76.75 Uncharacterized protein DR_0824Deinococcus radiodurans 2.30.40.10 69 14 61 3.02 4.88
1ejxC01 76.11 Arginine and proline metabolismKlebsiella aerogenesPurine metabolismUrease alpha subunit [EC:3.5.1.5]Atrazine degradation 2.30.40.10 185 18 47 2.07 4.35
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r8cA01
TTFLFRNGALLDPDHPDLLQGFEILIEDGFIREVSDKPIKSSNAHVIDVKGKTIMPGDKLGRIVPGAHADVLVVDGNPLK
SVDCLLGQGEHIPLVMKDGRLFVNELE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r8cA01
MSLTTFLFRNGALLDPDHPDLLQGFEILIEDGFIREVSDKPIKSSNAHVIDVKGKTIMPGDKLGRIVPGAHADVLVVDGN
PLKSVDCLLGQGEHIPLVMKDGRLFVNELEGHEGHHHHHH
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 03 Mar 2009 21:47

Assigning to "2.30.40.10" based on similarity with "2r8cG01"

Flow stage update by auto on 03 Mar 2009 21:45

No in_process hits for Domain "2r8cA01" ready to be processed

Update comment by auto on 03 Mar 2009 21:28

Domain "2r8cA01" hits Domain "2r8cG01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 21:00

Domain "2r8cA01" hits Domain "2r8cC01" (100% over 100%) which is currently in process

Update comment by auto on 23 Sep 2008 23:19

Domain "2r8cA01" hits Domain "3be7C01" (39.8148148148148% over 87.5%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

Domain "2r8cA01" hits Domain "3be7C01" (39.8148148148148% over 87.5%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

NW result present for Domain "2r8cA01"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r8cA01"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r8cA01"

Insertion by cuff on 22 Sep 2008 12:25

nice chopping