CATH Domain: 2r85A03 XML data for domain: 2r85A03

Molscript image for 2r85A03
2r85A03
PDB coordinates for domain 2r85A03

PDB 2r85, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.10
3.30.1490.20.10.1
3.30.1490.20.10.1.1
3.30.1490.20.10.1.1.1
3.30.1490.20.10.1.1.1.1

[top]
Segment boundaries for domain 2r85A03

Chopping figure for domain 2r85A03
DomainStart PDB ResidueStop PDB Residue
2r85A01 1 87
2r85A02 88 115
2r85A02 178 334
2r85A03 116 177

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i7nA01 83.13 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 17 83 2.92 3.50
2pbzA03 80.20 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC:6.3.4.-]Purine metabolismThermococcus kodakarensisMetabolic pathwaysPutative uncharacterized protein 3.30.1490.20 38 10 60 1.61 2.67
1ehiA03 79.67 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 15 75 3.70 4.93
1m0wB05 79.42 Glutathione synthase [EC:6.3.2.3]Glutathione bindingProtein homodimerization activityGlutathione metabolismMetabolic pathways 3.30.1490.50 60 6 78 2.92 3.73
1un6D02 74.93 Xenopus laevisTranscription factor IIIA 3.30.160.60 31 9 53 1.87 3.50
1lkoA02 74.31 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 2.20.28.10 45 2 70 3.37 4.77
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r85A03
PEVYEDPDDIEKPVIVKPHGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r85A03
PEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVL
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 25 Mar 2009 17:33

Assigning to "3.30.1490.20" based on similarity with "2r84A03"

Flow stage update by auto on 25 Mar 2009 17:13

No in_process hits for Domain "2r85A03" ready to be processed

Update comment by auto on 13 Jan 2009 12:01

Domain "2r85A03" hits Domain "2r84B03" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2009 11:59

Domain "2r85A03" hits Domain "2r84A03" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2009 11:56

Domain "2r85A03" hits Domain "2r7kA03" (53.2258064516129% over 96.875%) which is currently in process

Update comment by auto on 13 Jan 2009 11:54

Domain "2r85A03" hits Domain "2r7lA03" (53.2258064516129% over 96.875%) which is currently in process

Update comment by auto on 13 Jan 2009 11:51

Domain "2r85A03" hits Domain "2r7nA03" (53.2258064516129% over 96.875%) which is currently in process

Update comment by auto on 23 Sep 2008 23:19

Domain "2r85A03" hits Domain "2r7mA03" (53.2258064516129% over 96.875%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

Domain "2r85A03" hits Domain "2r7mA03" (53.2258064516129% over 96.875%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

NW result present for Domain "2r85A03"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r85A03"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r85A03"

Insertion by auto on 22 Sep 2008 14:39

Final ChopClose added based on similarity with "2r84A"