Domain assigned by auto on 24 Sep 2008 06:18
Assigning to "3.30.470.20" based on similarity with "2r84A02"
CATH Domain: 2r85A02
2r85A02
PDB 2r85, Chain A, Domain 2
Segment boundaries for domain 2r85A02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2r85A01 | 1 | 87 |
| 2r85A02 | 88 | 115 |
| 2r85A02 | 178 | 334 |
| 2r85A03 | 116 | 177 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.3.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1iowA02 | 74.65 | 3.30.470.20 | 149 | 10 | 73 | 3.56 | 4.84 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2r85A02 YFGNKRVLRWESDRNLERKWLKKAGIRVGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTV IGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRP VSTGRRIAMEIREAIENDMLEKVLT
Domain History Events (12)
Flow stage update by auto on 24 Sep 2008 05:40
No in_process hits for Domain "2r85A02" ready to be processed
Update comment by auto on 24 Sep 2008 04:55
Domain "2r85A02" hits Domain "2r84A02" (100% over 100%) which is currently in process
Update comment by auto on 24 Sep 2008 04:08
Domain "2r85A02" hits Domain "2r7lA02" (52.4324324324324% over 99.4623655913979%) which is currently in process
Update comment by auto on 24 Sep 2008 03:24
Domain "2r85A02" hits Domain "2r7nA02" (52.4324324324324% over 99.4623655913979%) which is currently in process
Update comment by auto on 24 Sep 2008 02:37
Domain "2r85A02" hits Domain "2r7kA02" (52.4324324324324% over 99.4623655913979%) which is currently in process
Update comment by auto on 23 Sep 2008 23:19
Domain "2r85A02" hits Domain "2r7mA02" (52.4324324324324% over 99.4623655913979%) which is currently in process
Flow stage update by auto on 23 Sep 2008 23:17
Domain "2r85A02" hits Domain "2r7mA02" (52.4324324324324% over 99.4623655913979%) which is currently in process
Flow stage update by auto on 23 Sep 2008 23:17
NW result present for Domain "2r85A02"
Flow stage update by auto on 23 Sep 2008 08:17
All required files are present for Domain "2r85A02"
Flow stage update by auto on 22 Sep 2008 15:12
Beginning processing for Domain "2r85A02"
Insertion by auto on 22 Sep 2008 14:39
Final ChopClose added based on similarity with "2r84A"
