CATH Domain: 2r7kA01 XML data for domain: 2r7kA01

Molscript image for 2r7kA01
2r7kA01
PDB coordinates for domain 2r7kA01

PDB 2r7k, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.20 Gene3D
3.40.50.20.7
3.40.50.20.7.1
3.40.50.20.7.1.1
3.40.50.20.7.1.1.1
3.40.50.20.7.1.1.1.1

[top]
Segment boundaries for domain 2r7kA01

Chopping figure for domain 2r7kA01
DomainStart PDB ResidueStop PDB Residue
2r7kA01 1 111
2r7kA02 112 139
2r7kA02 204 361
2r7kA03 140 203

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.50.20.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dv1B01 77.97 Pyruvate metabolismFatty acid biosynthesisPropanoate metabolismMetabolic pathwaysFatty acid biosynthetic process 3.40.50.20 85 15 71 2.87 4.03
1ulzA01 76.75 Pyruvate carboxylase subunit A [EC:6.4.1.1]Citrate cycle (TCA cycle)Pyruvate metabolismPyruvate carboxylase n-terminal domainAquifex aeolicus 3.40.50.20 129 10 72 3.34 4.63
2ho3A01 76.18 Oxidoreductase, Gfo/Idh/MocA familyStreptococcus pneumoniae 3.40.50.720 113 7 71 3.05 4.25
1m1nB03 75.60 Nitrogenase molybdenum-iron protein beta chain [EC:1.18.6.1]Nitrogen metabolismAzotobacter vinelandiiNitrogenase molybdenum-iron protein beta chainMetabolic pathways 3.40.50.1980 106 7 70 3.36 4.78
1f2dA02 74.76 Williopsis saturnus1-aminocyclopropane-1-carboxylate deaminase 3.40.50.1100 102 10 71 3.39 4.76
2aefA01 74.50 Methanothermobacter thermautotrophicus str. Delta HCalcium-gated potassium channel mthK 3.40.50.720 115 8 73 3.11 4.21
2pfsA01 74.48 Universal stress protein (Usp)Nitrosomonas europaeaUniversal stress protein A 3.40.50.620 114 11 78 3.45 4.42
1vkzA01 74.34 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.40.50.20 77 12 64 2.80 4.32
1ydwA01 73.30 Arabidopsis thalianaUncharacterized oxidoreductase At4g09670 3.40.50.720 124 5 64 3.08 4.77
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r7kA01
MISKDEILEIFDKYNKDEITIATLGSHTSLHILKGAKLEGFSTVCITMKGRDVPYKRFKVADKFIYVDNFSDIKNEEIQE
KLRELNSIVVPHGSFIAYCGLDNVENSFLVP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r7kA01
MISKDEILEIFDKYNKDEITIATLGSHTSLHILKGAKLEGFSTVCITMKGRDVPYKRFKVADKFIYVDNFSDIKNEEIQE
KLRELNSIVVPHGSFIAYCGLDNVENSFLVP
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 13 Jan 2009 11:56

Assigning to "3.40.50.20" based on similarity with "2r7lA01"

Flow stage update by auto on 13 Jan 2009 11:54

No in_process hits for Domain "2r7kA01" ready to be processed

Update comment by auto on 13 Jan 2009 11:51

Domain "2r7kA01" hits Domain "2r7lA01" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2009 11:37

Domain "2r7kA01" hits Domain "2r7nA01" (100% over 100%) which is currently in process

Update comment by auto on 23 Sep 2008 23:19

Domain "2r7kA01" hits Domain "2r7mA01" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

Domain "2r7kA01" hits Domain "2r7mA01" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

NW result present for Domain "2r7kA01"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r7kA01"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r7kA01"

Insertion by auto on 22 Sep 2008 14:09

Final ChopClose added based on similarity with "2r7mA"