CATH Domain: 2r7hB00 XML data for domain: 2r7hB00

Molscript image for 2r7hB00
2r7hB00
PDB coordinates for domain 2r7hB00

PDB 2r7h, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.15
3.40.630.30.15.1
3.40.630.30.15.1.1
3.40.630.30.15.1.1.1
3.40.630.30.15.1.1.1.1

[top]
Segment boundaries for domain 2r7hB00

Chopping figure for domain 2r7hB00
DomainStart PDB ResidueStop PDB Residue
2r7hB00 18 176

Structural Neighbourhood (57 entries)

There are 57 matching structural neighberhood comparisons for CATH ID 3.40.630.30.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 57 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3k9uA00 86.19 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 14 88 2.13 2.40
2fiaA00 85.87 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 157 14 91 2.46 2.68
1tiqB00 85.70 Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1 3.40.630.30 161 14 91 2.98 3.26
2ae6A00 85.61 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 20 85 3.91 4.55
2ge3B00 85.51 Agrobacterium tumefaciens str. C58Probable acetyltransferase 3.40.630.30 159 14 91 2.79 3.04
2i79D00 85.02 Acetyltransferase, GNAT familyStreptococcus pneumoniae 3.40.630.30 167 16 91 2.83 3.09
1s3zA00 84.80 Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase 3.40.630.30 147 14 85 4.06 4.76
3g8wA00 84.74 Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05 3.40.630.30 158 12 94 2.60 2.76
2q7bA00 84.72 Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V 3.40.630.30 161 14 92 4.33 4.68
3d8pB00 84.64 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 157 14 94 4.46 4.73
2fiwA00 84.59 Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris 3.40.630.30 156 13 85 2.97 3.45
1n71B00 84.39 Aac(6')-Ii proteinEnterococcus faecium 3.40.630.30 179 17 83 2.19 2.61
3exnA00 84.12 Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation 3.40.630.30 151 16 91 2.85 3.11
1q2yA00 83.75 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 12 86 3.58 4.13
3d3sA00 83.72 L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways 3.40.630.30 157 14 92 2.94 3.16
3efaA00 83.40 Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation 3.40.630.30 141 11 86 2.74 3.16
1cjwA00 83.33 Ovis ariesSerotonin N-acetyltransferase 3.40.630.30 166 15 88 3.06 3.46
2pdoA01 83.23 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 18 74 2.12 2.84
3fb3A00 83.04 Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei 3.40.630.30 141 17 85 3.76 4.41
1qsmD00 82.73 CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2 3.40.630.30 152 13 90 3.00 3.32
2i00C01 82.44 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 8 80 2.18 2.72
3fbuA00 82.35 Bacillus anthracisAcetyltransferase, GNAT family 3.40.630.30 166 12 88 2.96 3.34
1xebA00 82.28 Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein 3.40.630.30 146 13 87 2.96 3.39
2ozgA01 82.14 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 117 15 73 2.60 3.52
1y9wA01 82.09 AcetyltransferaseBacillus cereus ATCC 14579 3.40.630.30 104 15 64 1.93 2.97
3eo4A00 82.07 Methanocaldococcus jannaschiiUncharacterized protein MJ1062 3.40.630.30 155 9 87 3.31 3.79
3f5bA00 82.04 Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1 3.40.630.30 163 10 90 3.51 3.89
2dxqA00 82.00 Agrobacterium tumefaciens str. C58Acetyltransferase 3.40.630.30 145 15 87 3.73 4.24
1ufhA00 81.65 Uncharacterized N-acetyltransferase yycNBacillus subtilis 3.40.630.30 155 11 89 4.11 4.61
2hqyA02 81.42 Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein 3.40.630.30 164 6 75 2.43 3.21
2r1iA01 81.31 Arthrobacter sp. FB24GCN5-related N-acetyltransferase 3.40.630.30 129 27 77 2.98 3.83
2pr1A00 81.24 Uncharacterized N-acetyltransferase ylbPBacillus subtilis 3.40.630.30 152 11 85 4.02 4.68
1y7rA00 81.04 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 125 12 78 3.05 3.89
1y9kA01 80.96 Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation 3.40.630.30 110 20 69 3.36 4.84
2qecA00 80.94 Corynebacterium glutamicumGCN5-related N-acetyltransferase 3.40.630.30 175 12 80 2.97 3.69
1m4iB00 80.67 Aminoglycoside 2'-N-acetyltransferaseMycobacterium tuberculosis 3.40.630.30 176 14 79 3.33 4.19
1bo4A00 80.59 Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens 3.40.630.30 136 9 82 3.27 3.98
1yreC00 80.55 Pseudomonas aeruginosaPutative uncharacterized protein 3.40.630.30 182 12 83 3.08 3.69
2fckA00 80.51 Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative 3.40.630.30 171 12 87 3.89 4.43
1u6mA00 80.48 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 188 14 78 3.83 4.90
2g3aA02 80.37 Agrobacterium tumefaciens str. C58Acetyltransferase 3.40.630.30 97 18 59 2.08 3.51
1sqhA02 80.22 Drosophila melanogasterCG14615 3.40.630.30 128 14 70 2.32 3.28
2q0yA01 80.16 Ralstonia eutropha JMP134GCN5-related N-acetyltransferase 3.40.630.30 125 12 73 2.88 3.93
2fl4A02 79.88 Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis 3.40.630.30 104 15 64 2.39 3.68
1lrzA01 79.14 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 143 7 80 3.33 4.12
2ozhA01 78.99 Xanthomonas campestris pv. campestrisPutative uncharacterized protein 3.40.630.30 120 16 74 3.51 4.71
3ey5A01 78.84 Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron 3.40.630.30 144 16 77 3.18 4.09
1ro5A01 78.34 Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase 3.40.630.30 187 8 77 3.52 4.57
1nslA00 78.33 Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF 3.40.630.30 173 11 87 3.70 4.21
1bobA02 77.84 Chromatin silencing at telomereHistone acetyltransferase 1 [EC:2.3.1.48]Histone acetyltransferase type B catalytic subunitHistone acetyltransferase activityProtein binding 3.40.630.30 124 8 63 3.08 4.84
2hv2A03 77.33 Enterococcus faecalisPutative uncharacterized protein 3.40.630.30 148 9 80 3.98 4.96
1lrzA02 77.07 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 195 7 63 2.85 4.52
2qmlA00 76.62 BH2621 proteinBacillus halodurans 3.40.630.30 184 9 76 3.39 4.46
1kzfA00 76.53 Pantoea stewartii subsp. stewartiiAcyl-homoserine-lactone synthase 3.40.630.30 198 7 64 2.89 4.47
2q04F00 75.98 Acetoin utilization proteinAcetoin utilization protein AcuA [EC:2.3.1.-]Exiguobacterium sibiricum 255-15 3.40.630.30 196 10 72 3.59 4.96
1rxtC01 75.51 Glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]Protein lipoylationHomo sapiensGlycylpeptide N-tetradecanoyltransferase 1 3.40.630.30 132 7 78 3.83 4.89
3dsbA01 75.22 Putative acetyltransferaseClostridium difficile 630 3.40.630.30 96 14 57 2.85 4.97
[1]
Displaying entries 1 to 57 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r7hB00
AVAFRRQVLPQDALLVRRVVESTGFFTPEEADVAQELVDEHLHGAACGYHFVFATEDDDAGYACYGPTPATEGTYDLYWI
AVAPHRQHSGLGRALLAEVVHDVRLTGGRLLFAETSGIRKYAPTRRFYERAGFSAEAVLKAFYRAGDDKIIYRLEVA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r7hB00
AVAFRRQVLPQDALLVRRVVESTGFFTPEEADVAQELVDEHLXHGAACGYHFVFATEDDDXAGYACYGPTPATEGTYDLY
WIAVAPHRQHSGLGRALLAEVVHDVRLTGGRLLFAETSGIRKYAPTRRFYERAGFSAEAVLKAFYRAGDDKIIYRLEVA
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 Jan 2009 11:50

Assigning to "3.40.630.30" based on similarity with "2r7hA00"

Flow stage update by auto on 13 Jan 2009 11:37

No in_process hits for Domain "2r7hB00" ready to be processed

Update comment by auto on 23 Sep 2008 23:19

Domain "2r7hB00" hits Domain "2r7hA00" (98.7421383647799% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

Domain "2r7hB00" hits Domain "2r7hA00" (98.7421383647799% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 23:17

NW result present for Domain "2r7hB00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r7hB00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r7hB00"

Insertion by auto on 22 Sep 2008 14:04

Final ChopClose added based on similarity with "2r7hA"