CATH Domain: 2r6uA01

2r6uA01

PDB 2r6u, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.10	Roll
3.10.180	2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.10	2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	Gene3D
3.10.180.10.13
3.10.180.10.13.1
3.10.180.10.13.1.1
3.10.180.10.13.1.1.1
3.10.180.10.13.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2r6uA01

Domain	Start PDB Residue	Stop PDB Residue
2r6uA01	4	125

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.10.180.10.13.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3hdpA00	81.93	Clostridium acetobutylicumLactoylglutathione lyase, YQJC B.subtilis ortholog	3.10.180.10	132	12	81	2.51	3.07
2rk9B00	81.36	Glyoxalase/bleomycin resistance protein/dioxygenaseVibrio splendidus 12B01	3.10.180.10	115	13	87	4.24	4.83
3b59A01	80.57	Glyoxalase/bleomycin resistance protein/dioxygenaseNovosphingobium aromaticivorans DSM 12444	3.10.180.10	121	14	89	3.58	4.01
1jc4A00	79.21	Propionibacterium freudenreichii subsp. shermaniiMethylmalonyl CoA epimerase	3.10.180.10	139	13	82	3.89	4.70
2zyqA01	77.05	Biphenyl degradationGamma-Hexachlorocyclohexane degradationMetabolic pathwaysBiphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]Extradiol ring-cleavage dioxygenase	3.10.180.10	131	8	85	4.26	4.98
1tsjA00	76.68	Staphylococcus aureus subsp. aureus MW2Putative uncharacterized protein MW1090	3.10.180.10	111	15	81	3.46	4.26
1cjxA01	75.35	4-hydroxyphenylpyruvate dioxygenasePseudomonas sp. 'P.J. 874'	3.10.180.10	150	10	72	3.55	4.93

[top]
Domain ATOM Sequence

>pdb|2r6uA01
RIVHFEIPFDDGDRARAFYRDAFGWAIAEIPDMDYSMVTTGPVGESGMPDEPGYINGGMMQRGEVTTPVVTVDVESIESA
LERIESLGGKTVTGRTPVGNMGFAAYFTDSEGNVVGLWETAR

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2r6uA01
RIVHFEIPFDDGDRARAFYRDAFGWAIAEIPDMDYSMVTTGPVGESGMPDEPGYINGGMMQRGEVTTPVVTVDVESIESA
LERIESLGGKTVTGRTPVGNMGFAAYFTDSEGNVVGLWETARGS

BLAST against CATH

[top]
Domain History Events (108)

Domain assigned by cuff on 13 Jan 2009 10:58

same superfamily

Domain assignment manual match h by cuff on 13 Jan 2009 10:57

homology match

Homcheck allotment by cuff on 13 Jan 2009 10:57

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 13 Jan 2009 10:57

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 04 Nov 2008 17:53

Domain "2r6uA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 04 Nov 2008 17:52

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r6uA01

Flow stage update by auto on 04 Nov 2008 17:49

Retrieved PRC_PFAMCATH results for job ID SID2837000574428720 and results inserted.

Domain scan prc pfamcath by auto on 04 Nov 2008 17:49

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 37 results for 2r6uA01

Update comment by auto on 04 Nov 2008 14:51

PRC_PFAMCATH job SID2837000574428720 is not yet finished.

Flow stage update by auto on 04 Nov 2008 14:47

The entry "2r6uA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 04 Nov 2008 14:47

The entry "2r6uA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 04 Nov 2008 14:35

Retrieved SSAP results for job ID SID7283245363000264 and results inserted.

Domain scan ssap cath by auto on 04 Nov 2008 14:33

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1343 results for 2r6uA01

Update comment by auto on 03 Nov 2008 17:46

SSAP job SID7283245363000264 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:33

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:33

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:31

Giving up on SSAP job SID2806422414081168 because submission time of Tue Oct 28 12:10:27 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:31:12 2008).

Update comment by auto on 28 Oct 2008 12:29

SSAP job SID2806422414081168 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:10

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:10

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:55

Giving up on SSAP job SID7641733730417792 because submission time of Wed Oct 22 09:22:55 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:55:33 2008).

Update comment by auto on 22 Oct 2008 09:41

SSAP job SID7641733730417792 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:22

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:22

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:17

Giving up on SSAP job SID8397542207917136 because submission time of Thu Oct 16 06:01:40 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:17:43 2008).

Update comment by auto on 16 Oct 2008 06:19

SSAP job SID8397542207917136 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:01

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:01

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:30

Giving up on SSAP job SID9607427180465172 because submission time of Fri Oct 10 03:01:07 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:30:20 2008).

Update comment by auto on 10 Oct 2008 03:39

SSAP job SID9607427180465172 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:01

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:01

The entry "2r6uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:22

Retrieved PRC results for job ID SID1707531729563888 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:21

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 34 results for 2r6uA01

Update comment by auto on 09 Oct 2008 00:16

PRC job SID1707531729563888 is not yet finished.

Flow stage update by auto on 08 Oct 2008 23:57

The entry "2r6uA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 23:57

The entry "2r6uA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 23:42

Retrieved HMM(SAM) results for job ID SID6416152483977464 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 23:42

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 26 results for 2r6uA01