CATH Domain: 2r6jA02 XML data for domain: 2r6jA02

Molscript image for 2r6jA02
2r6jA02
PDB coordinates for domain 2r6jA02

PDB 2r6j, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.25 UDP-galactose 4-epimerase; domain 1
3.90.25.10 UDP-galactose 4-epimerase, domain 1 Gene3D
3.90.25.10.9
3.90.25.10.9.1
3.90.25.10.9.1.1
3.90.25.10.9.1.1.1
3.90.25.10.9.1.1.1.1

[top]
Segment boundaries for domain 2r6jA02

Chopping figure for domain 2r6jA02
DomainStart PDB ResidueStop PDB Residue
2r6jA01 5 150
2r6jA01 187 209
2r6jA01 275 287
2r6jA02 151 186
2r6jA02 210 274
2r6jA02 288 314

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.25.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eq2D02 75.75 Metabolic pathwaysLipopolysaccharide biosynthesisMembraneProtein bindingADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20] 3.90.25.10 101 8 67 3.27 4.81
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r6jA02
ANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPE
PENIPIAILHCLFIDGATMSYPELKFTTIDELLDIFVHDPPPPASAAF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r6jA02
ANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPE
PENIPIAILHCLFIDGATMSYPELKFTTIDELLDIFVHDPPPPASAAF
BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 20 Oct 2008 15:43

Assigning to "3.90.25.10" based on similarity with "2qx7A02"

Flow stage update by auto on 20 Oct 2008 15:42

No in_process hits for Domain "2r6jA02" ready to be processed

Update comment by auto on 20 Oct 2008 15:40

Domain "2r6jA02" hits Domain "2r2gB02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:38

Domain "2r6jA02" hits Domain "2r2gA02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:36

Domain "2r6jA02" hits Domain "2qzzB02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:34

Domain "2r6jA02" hits Domain "2qzzA02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:32

Domain "2r6jA02" hits Domain "2qysB02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:30

Domain "2r6jA02" hits Domain "2qysA02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:28

Domain "2r6jA02" hits Domain "2qx7B02" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:26

Domain "2r6jA02" hits Domain "2qx7A02" (100% over 100%) which is currently in process

Update comment by auto on 14 Sep 2008 23:08

Domain "2r6jA02" hits Domain "1qycA02" (40% over 91.40625%) which is currently in process

Flow stage update by auto on 14 Sep 2008 23:07

Domain "2r6jA02" hits Domain "1qycA02" (40% over 91.40625%) which is currently in process

Flow stage update by auto on 14 Sep 2008 23:07

NW result present for Domain "2r6jA02"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2r6jA02"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2r6jA02"

Insertion by auto on 10 Sep 2008 15:56

Final ChopClose added based on similarity with "2qx7A"