CATH Domain: 2r6hA02 XML data for domain: 2r6hA02

Molscript image for 2r6hA02
2r6hA02
PDB coordinates for domain 2r6hA02

PDB 2r6h, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.80 Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module Gene3D
3.40.50.80.14
3.40.50.80.14.1
3.40.50.80.14.1.1
3.40.50.80.14.1.1.1
3.40.50.80.14.1.1.1.1

[top]
Segment boundaries for domain 2r6hA02

Chopping figure for domain 2r6hA02
DomainStart PDB ResidueStop PDB Residue
2r6hA01 128 270
2r6hA02 282 399

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.50.80.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2aefA01 77.36 Methanothermobacter thermautotrophicus str. Delta HCalcium-gated potassium channel mthK 3.40.50.720 115 4 66 2.55 3.81
1pjqA01 77.09 Porphyrin and chlorophyll metabolismSalmonella enterica subsp. enterica serovar TyphimuriumSiroheme synthaseUroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]Metabolic pathways 3.40.50.720 112 8 67 3.35 4.96
1l1sA00 76.57 Hypothetical proteinMethanothermobacter thermautotrophicus str. Delta HPutative uncharacterized protein 3.40.1260.10 108 6 77 3.84 4.97
2x5oA01 73.84 D-Glutamine and D-glutamate metabolismPeptidoglycan biosynthesisMetabolic pathwaysUDP-N-acetylmuramoylalanine--D-glutamate ligaseUDP-N-acetylmuramoylalanine-D-glutamate ligase activity 3.40.50.720 92 6 65 3.26 4.96
3fwzA00 72.34 Inner membrane protein ybaLMonovalent cation:H+ antiporter-2, CPA2 familyEscherichia coli K-12 3.40.50.720 137 7 58 2.90 4.97
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r6hA02
LYIGGGAGAPLRAQILHLFRTLKTGRKVSYWYGARSKNEIFYEEDFREIEREFPNFKFHIALSDPQPEDNWTGYVGFIHQ
VIYDNYLKDHDAPEDIEYYCGPGPANAVKGLENL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r6hA02
LYIGGGAGXAPLRAQILHLFRTLKTGRKVSYWYGARSKNEIFYEEDFREIEREFPNFKFHIALSDPQPEDNWTGYVGFIH
QVIYDNYLKDHDAPEDIEYYXCGPGPXANAVKGXLENL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 Jan 2009 11:50

Assigning to "3.40.50.80" based on similarity with "2r6hD02"

Flow stage update by auto on 13 Jan 2009 11:37

No in_process hits for Domain "2r6hA02" ready to be processed

Update comment by auto on 23 Sep 2008 20:17

Domain "2r6hA02" hits Domain "2r6hD02" (96.6101694915254% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 20:15

Domain "2r6hA02" hits Domain "2r6hD02" (96.6101694915254% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 20:15

NW result present for Domain "2r6hA02"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r6hA02"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r6hA02"

Insertion by auto on 22 Sep 2008 14:14

Final ChopClose added based on similarity with "2r6hB"