Domain assigned by cuff on 19 Mar 2009 12:28
same superfamily
CATH Domain: 2r6fA03
2r6fA03
PDB 2r6f, Chain A, Domain 3
Segment boundaries for domain 2r6fA03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2r6fA01 | 3 | 90 |
| 2r6fA01 | 486 | 586 |
| 2r6fA02 | 91 | 129 |
| 2r6fA02 | 248 | 281 |
| 2r6fA02 | 404 | 485 |
| 2r6fA03 | 130 | 247 |
| 2r6fA04 | 282 | 403 |
| 2r6fA05 | 587 | 687 |
| 2r6fA05 | 827 | 948 |
| 2r6fA06 | 689 | 826 |
Structural Neighbourhood (2 entries)
There are 2 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.16.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 2 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1x9nA02 | 77.92 | 3.30.1490.70 | 83 | 12 | 77 | 3.82 | 4.95 | |
|
1ta8A02 | 74.77 | 3.30.1490.70 | 99 | 5 | 66 | 2.83 | 4.25 |
[1]
Displaying entries 1 to 2 (page 1 of 1)
Domain ATOM Sequence
>pdb|2r6fA03 QTIEQVDRLLSYPERTKQILAPIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVIGEGELLFSEK
Domain History Events (83)
Domain assignment manual match h by cuff on 19 Mar 2009 12:22
same superfamily
Homcheck allotment by cuff on 19 Mar 2009 12:20
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 19 Mar 2009 12:20
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 16 Mar 2009 06:37
Domain "2r6fA03" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 16 Mar 2009 06:36
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r6fA03
Flow stage update by auto on 16 Mar 2009 03:28
Retrieved PRC_PFAMCATH results for job ID SID1898434653221536 and results inserted.
Domain scan prc pfamcath by auto on 16 Mar 2009 03:27
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2r6fA03
Update comment by auto on 14 Mar 2009 10:52
PRC_PFAMCATH job SID1898434653221536 is not yet finished.
Flow stage update by auto on 14 Mar 2009 10:45
The entry "2r6fA03" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 14 Mar 2009 10:45
The entry "2r6fA03" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 14 Mar 2009 10:28
Retrieved SSAP results for job ID SID4278508539309392 and results inserted.
Domain scan ssap cath by auto on 14 Mar 2009 10:22
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 4168 results for 2r6fA03
Update comment by auto on 10 Mar 2009 02:33
SSAP job SID4278508539309392 is not yet finished.
Ssap cath submit by auto on 10 Mar 2009 02:20
The entry "2r6fA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Mar 2009 02:20
The entry "2r6fA03" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Mar 2009 01:36
Retrieved PRC results for job ID SID4874867597802920 and inserted them into the database.
Domain scan prc cath by auto on 10 Mar 2009 01:36
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2r6fA03
Update comment by auto on 09 Mar 2009 19:59
PRC job SID4874867597802920 is not yet finished.
Prc cath submit by auto on 09 Mar 2009 19:42
The entry "2r6fA03" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 19:42
The entry "2r6fA03" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 18:56
Retrieved HMM(SAM) results for job ID SID2164322141971468 and inserted them into the database.
Domain scan sam cath by auto on 09 Mar 2009 18:56
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2r6fA03
Update comment by auto on 04 Mar 2009 16:09
HMM(SAM) job SID2164322141971468 is not yet finished.
Flow stage update by auto on 04 Mar 2009 15:59
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Mar 2009 15:59
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 12:37
Unable to retrieve "2r6fA03" HMM(SAM) results for job "SID3227796572946528"
Update comment by auto on 04 Mar 2009 04:12
HMM(SAM) job SID3227796572946528 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 04:00
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 04:00
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 00:49
Unable to retrieve "2r6fA03" HMM(SAM) results for job "SID7018834735705248"
Flow stage update by auto on 03 Mar 2009 23:30
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 03 Mar 2009 23:30
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 15:51
Unable to retrieve "2r6fA03" HMM(SAM) results for job "SID3480263270180576"
Update comment by auto on 19 Feb 2009 08:32
HMM(SAM) job SID3480263270180576 is not yet finished.
Sam cath submit by auto on 19 Feb 2009 08:04
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 08:04
The entry "2r6fA03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 07:29
Retrieved "2r6fA03" CATHEDRAL results for job ID SID5928901285318048 and inserted them into the database.
Domain scan cathedral cath by auto on 19 Feb 2009 07:28
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 284 results for 2r6fA03
Flow stage update by auto on 19 Feb 2009 06:20
The entry "2r6fA03" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 19 Feb 2009 06:20
The entry "2r6fA03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2009 11:57
Unable to retrieve "2r6fA03" CATHEDRAL results for job "SID0059388371086160"
Update comment by auto on 22 Jan 2009 17:08
"2r6fA03" CATHEDRAL job SID0059388371086160 is not yet finished.
Cathedral cath submit by auto on 22 Jan 2009 16:34
The entry "2r6fA03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Jan 2009 16:34
The entry "2r6fA03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 21 Dec 2008 14:55
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2r6fA03.scanlist" for "2r6fA03"
Write scan list by auto on 21 Dec 2008 14:55
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2r6fA03.scanlist" for domain "2r6fA03"
Update comment by auto on 21 Dec 2008 11:52
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 20:42
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 19:04
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 14:36
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 11:35
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 07:50
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 03:58
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 00:49
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 20:42
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 16:55
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 11:34
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 23:33
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 22:12
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 17:38
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 14:52
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 11:32
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 09:47
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 04:25
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 00:27
Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 20:35
Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 18:32
Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 14:43
Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 10:54
Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 20:40
Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 17:13
Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 20:41
Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 17:18
Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 20:37
Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 16:50
Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Dec 2008 20:55
Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Flow stage update by auto on 12 Dec 2008 20:53
No satisfactory AssignClose result found.
Flow stage update by auto on 12 Dec 2008 20:36
No in_process hits for Domain "2r6fA03" ready to be processed
Flow stage update by auto on 12 Dec 2008 20:35
NW result present for Domain "2r6fA03"
Flow stage update by auto on 10 Dec 2008 14:16
All required files are present for Domain "2r6fA03"
Flow stage update by auto on 10 Dec 2008 14:14
Beginning processing for Domain "2r6fA03"
Insertion by cuff on 08 Dec 2008 12:31
nice chopping
