CATH Domain: 2r5sA02 XML data for domain: 2r5sA02

Molscript image for 2r5sA02
2r5sA02
PDB coordinates for domain 2r5sA02

PDB 2r5s, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.10 Gene3D
1.25.40.10.18
1.25.40.10.18.1
1.25.40.10.18.1.1
1.25.40.10.18.1.1.1
1.25.40.10.18.1.1.1.1

[top]
Segment boundaries for domain 2r5sA02

Chopping figure for domain 2r5sA02
DomainStart PDB ResidueStop PDB Residue
2r5sA01 114 196
2r5sA02 197 284

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.25.40.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2b6cA02 78.23 Enterococcus faecalisPutative uncharacterized protein 1.25.40.290 89 5 87 3.72 4.24
1mqsA04 76.45 ER to Golgi transport vesicleER to Golgi vesicle-mediated transportSNARE bindingRegulation of Ras protein signal transductionRetrograde vesicle-mediated transport, Golgi to ER 1.25.40.60 101 5 72 3.42 4.73
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r5sA02
AESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFDILSALGQGNAIASKYRR
QLYSILY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r5sA02
AESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFXDILSALGQGNAIASKYR
RQLYSILY
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 Jan 2009 11:50

Assigning to "1.25.40.10" based on similarity with "2r5sB02"

Flow stage update by auto on 13 Jan 2009 11:37

No in_process hits for Domain "2r5sA02" ready to be processed

Update comment by auto on 21 Oct 2008 14:09

Domain "2r5sA02" hits Domain "2r5sB02" (98.8636363636364% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 14:07

Domain "2r5sA02" hits Domain "2r5sB02" (98.8636363636364% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 14:07

NW result present for Domain "2r5sA02"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "2r5sA02"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "2r5sA02"

Insertion by auto on 20 Oct 2008 17:09

Final ChopClose added based on similarity with "2r5sB"