CATH Domain: 2r5sA01 XML data for domain: 2r5sA01

Molscript image for 2r5sA01
2r5sA01
PDB coordinates for domain 2r5sA01

PDB 2r5s, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.10 Gene3D
1.25.40.10.19
1.25.40.10.19.1
1.25.40.10.19.1.1
1.25.40.10.19.1.1.1
1.25.40.10.19.1.1.1.1

[top]
Segment boundaries for domain 2r5sA01

Chopping figure for domain 2r5sA01
DomainStart PDB ResidueStop PDB Residue
2r5sA01 114 196
2r5sA02 197 284

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2r5sA01
DEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKLELH
QQA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r5sA01
SNASPDEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIA
KLELHQQA
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 Jan 2009 11:50

Assigning to "1.25.40.10" based on similarity with "2r5sB01"

Flow stage update by auto on 13 Jan 2009 11:37

No in_process hits for Domain "2r5sA01" ready to be processed

Update comment by auto on 21 Oct 2008 14:09

Domain "2r5sA01" hits Domain "2r5sB01" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 14:07

Domain "2r5sA01" hits Domain "2r5sB01" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 14:07

NW result present for Domain "2r5sA01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "2r5sA01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "2r5sA01"

Insertion by auto on 20 Oct 2008 17:09

Final ChopClose added based on similarity with "2r5sB"