Domain assigned by cuff on 08 Jan 2009 17:10
same superfamily
CATH Domain: 2r5fA00
2r5fA00
PDB 2r5f, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.1360
| Gene3D | |
 3.40.50.1360.6
| ||
 3.40.50.1360.6.1
| ||
 3.40.50.1360.6.1.1
| ||
 3.40.50.1360.6.1.1.1
| ||
 3.40.50.1360.6.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2r5fA00 QGLHLELETRLQKYGIRQVIVVEATEPDDEESIKQAIGSAAAHYLETSLSAQDHIGISSWSSTIRAVSHHPGKQSAQEVV QLLGGVGGAFEATLLTQRLATLLNCPAFLLPSQRIVEEEVKEVLHRFDSITLAIVGIGELELAERGAVGDICLRYFDAQG KPVVVSGLGKLRSINRVLGLAGGVRKVQAIKGALLGGYLDVLITDVGTARGLG
Domain COMBS Sequence
>pdb|2r5fA00 SNARPQGLHLELETRLQKXYGIRQVIVVEATEPDDEESIKQAIGSAAAHYLETSLSAQDHIGISSWSSTIRAXVSHXHPQ PGKQSAQEVVQLLGGVGNKGAFEATLLTQRLATLLNCPAFLLPSQSIEQSVESKQRIVEXEEVKEVLHRFDSITLAIVGI GELEPSQLLRNSGNYYTEDXLRVLAERGAVGDICLRYFDAQGKPVLEEDEEFVVSXGLGKLRSINRVLGLAGGVRKVQAI KGALLGGYLDVLITDVGTARGLGG
Domain History Events (110)
Domain assignment manual match h by cuff on 08 Jan 2009 17:10
homology match
Homcheck allotment by cuff on 08 Jan 2009 17:02
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 08 Jan 2009 17:02
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Nov 2008 14:36
Domain "2r5fA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Nov 2008 14:35
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r5fA00
Flow stage update by auto on 11 Nov 2008 14:35
Retrieved PRC_PFAMCATH results for job ID SID8956143344472864 and results inserted.
Domain scan prc pfamcath by auto on 11 Nov 2008 14:34
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 8 results for 2r5fA00
Update comment by auto on 11 Nov 2008 11:41
PRC_PFAMCATH job SID8956143344472864 is not yet finished.
Flow stage update by auto on 11 Nov 2008 11:39
The entry "2r5fA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 11 Nov 2008 11:39
The entry "2r5fA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Nov 2008 11:38
Retrieved SSAP results for job ID SID7387781936831376 and results inserted.
Domain scan ssap cath by auto on 11 Nov 2008 11:36
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1091 results for 2r5fA00
Update comment by auto on 09 Nov 2008 23:42
SSAP job SID7387781936831376 is not yet finished.
Ssap cath submit by auto on 09 Nov 2008 23:41
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Nov 2008 23:41
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Nov 2008 20:00
Giving up on SSAP job SID4916826598451376 because submission time of Mon Nov 3 17:33:11 2008 is more than 518400 seconds older than current time (Sun Nov 9 20:00:47 2008).
Update comment by auto on 03 Nov 2008 17:46
SSAP job SID4916826598451376 is not yet finished.
Ssap cath submit by auto on 03 Nov 2008 17:33
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 17:33
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 14:30
Giving up on SSAP job SID2233671838706944 because submission time of Tue Oct 28 12:09:58 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:30:51 2008).
Update comment by auto on 28 Oct 2008 12:29
SSAP job SID2233671838706944 is not yet finished.
Ssap cath submit by auto on 28 Oct 2008 12:09
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 12:09
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 08:55
Giving up on SSAP job SID6909271482443648 because submission time of Wed Oct 22 09:22:08 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:55:06 2008).
Update comment by auto on 22 Oct 2008 09:41
SSAP job SID6909271482443648 is not yet finished.
Flow stage update by auto on 22 Oct 2008 09:22
The entry "2r5fA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 22 Oct 2008 09:22
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:17
Giving up on SSAP job SID4587534900152328 because submission time of Thu Oct 16 06:01:11 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:17:11 2008).
Update comment by auto on 16 Oct 2008 06:18
SSAP job SID4587534900152328 is not yet finished.
Flow stage update by auto on 16 Oct 2008 06:01
The entry "2r5fA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 16 Oct 2008 06:01
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:29
Giving up on SSAP job SID8077020408684240 because submission time of Fri Oct 10 03:00:13 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:29:50 2008).
Update comment by auto on 10 Oct 2008 03:38
SSAP job SID8077020408684240 is not yet finished.
Ssap cath submit by auto on 10 Oct 2008 03:00
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 03:00
The entry "2r5fA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 01:18
Retrieved PRC results for job ID SID8741298175653400 and inserted them into the database.
Domain scan prc cath by auto on 10 Oct 2008 01:17
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2r5fA00
Update comment by auto on 09 Oct 2008 00:16
PRC job SID8741298175653400 is not yet finished.
Flow stage update by auto on 08 Oct 2008 23:56
The entry "2r5fA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 08 Oct 2008 23:56
The entry "2r5fA00" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 23:41
Retrieved HMM(SAM) results for job ID SID5974691999890432 and inserted them into the database.
Domain scan sam cath by auto on 08 Oct 2008 23:41
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2r5fA00
Update comment by auto on 04 Oct 2008 20:56
HMM(SAM) job SID5974691999890432 is not yet finished.
Sam cath submit by auto on 04 Oct 2008 20:43
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Oct 2008 20:43
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Oct 2008 17:52
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID7194084152547888"
Update comment by auto on 03 Oct 2008 03:52
HMM(SAM) job SID7194084152547888 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 03:30
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 03:30
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 00:33
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID2093517047965347"
Update comment by auto on 02 Oct 2008 21:03
HMM(SAM) job SID2093517047965347 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 20:42
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 20:42
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 18:23
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID2368516874790736"
Update comment by auto on 02 Oct 2008 15:10
HMM(SAM) job SID2368516874790736 is not yet finished.
Flow stage update by auto on 02 Oct 2008 14:50
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 02 Oct 2008 14:50
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 12:08
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID9457279822886656"
Update comment by auto on 02 Oct 2008 03:45
HMM(SAM) job SID9457279822886656 is not yet finished.
Flow stage update by auto on 02 Oct 2008 03:16
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 02 Oct 2008 03:16
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Oct 2008 21:01
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID7821007066334824"
Update comment by auto on 27 Sep 2008 12:23
HMM(SAM) job SID7821007066334824 is not yet finished.
Sam cath submit by auto on 27 Sep 2008 12:17
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Sep 2008 12:17
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Sep 2008 09:06
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID5394501420500944"
Update comment by auto on 26 Sep 2008 14:50
HMM(SAM) job SID5394501420500944 is not yet finished.
Flow stage update by auto on 26 Sep 2008 14:43
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 26 Sep 2008 14:43
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 12:23
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID9796410773942976"
Update comment by auto on 26 Sep 2008 09:12
HMM(SAM) job SID9796410773942976 is not yet finished.
Flow stage update by auto on 26 Sep 2008 09:05
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 26 Sep 2008 09:05
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 06:34
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID5875672273501824"
Update comment by auto on 26 Sep 2008 03:46
HMM(SAM) job SID5875672273501824 is not yet finished.
Sam cath submit by auto on 26 Sep 2008 03:37
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 03:37
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 00:01
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID4249206338437800"
Update comment by auto on 25 Sep 2008 20:48
HMM(SAM) job SID4249206338437800 is not yet finished.
Flow stage update by auto on 25 Sep 2008 20:45
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 25 Sep 2008 20:45
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 18:00
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID0035023770216720"
Update comment by auto on 25 Sep 2008 14:55
HMM(SAM) job SID0035023770216720 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 14:51
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 14:51
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 12:32
Unable to retrieve "2r5fA00" HMM(SAM) results for job "SID7502185518888457"
Update comment by auto on 25 Sep 2008 09:44
HMM(SAM) job SID7502185518888457 is not yet finished.
Sam cath submit by auto on 25 Sep 2008 09:40
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 09:40
The entry "2r5fA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 09:29
Retrieved "2r5fA00" CATHEDRAL results for job ID SID6638539526272754 and inserted them into the database.
Domain scan cathedral cath by auto on 25 Sep 2008 09:28
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 471 results for 2r5fA00
Update comment by auto on 25 Sep 2008 01:04
"2r5fA00" CATHEDRAL job SID6638539526272754 is not yet finished.
Flow stage update by auto on 25 Sep 2008 00:04
The entry "2r5fA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 25 Sep 2008 00:04
The entry "2r5fA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 24 Sep 2008 23:41
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2r5fA00.scanlist" for "2r5fA00"
Write scan list by auto on 24 Sep 2008 23:41
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2r5fA00.scanlist" for domain "2r5fA00"
Update comment by auto on 24 Sep 2008 21:15
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 17:32
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 12:06
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 08:50
Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 07:12
Waiting for 252 new domains (example : 2raeA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Sep 2008 23:39
Waiting for 283 new domains (example : 2r8cA02) to be processed so that they can be scanned against too.
Update comment by auto on 23 Sep 2008 20:34
Waiting for 343 new domains (example : 2r6vA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 23 Sep 2008 20:34
No satisfactory AssignClose result found.
Flow stage update by auto on 23 Sep 2008 20:15
No in_process hits for Domain "2r5fA00" ready to be processed
Flow stage update by auto on 23 Sep 2008 20:15
NW result present for Domain "2r5fA00"
Flow stage update by auto on 23 Sep 2008 08:17
All required files are present for Domain "2r5fA00"
Flow stage update by auto on 22 Sep 2008 15:12
Beginning processing for Domain "2r5fA00"
Insertion by cuff on 22 Sep 2008 11:48
nice chopping
