CATH Domain: 2r4rA00 XML data for domain: 2r4rA00

Molscript image for 2r4rA00
2r4rA00
PDB coordinates for domain 2r4rA00

PDB 2r4r, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1070 Rhopdopsin 7-helix transmembrane proteins
1.20.1070.10 Rhopdopsin 7-helix transmembrane proteins Gene3D
1.20.1070.10.7
1.20.1070.10.7.1
1.20.1070.10.7.1.2
1.20.1070.10.7.1.2.2
1.20.1070.10.7.1.2.2.1

[top]
Segment boundaries for domain 2r4rA00

Chopping figure for domain 2r4rA00
DomainStart PDB ResidueStop PDB Residue
2r4rA00 37 348

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1070.10.7.1.2.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3emlA01 87.05 Calcium signaling pathwayMembrane fractionIntegral to plasma membraneSensory perceptionCAMP biosynthetic process 1.20.1070.10 288 29 95 3.04 3.18
1hzxB00 83.18 RhodopsinBos taurusRhodopsin 1.20.1070.10 301 19 85 3.40 4.00
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r4rA00
GIVMSLIVLAIVFGNVLVITAIAFERLQTVTNYFITSLACADLVMGLAVVPFGFWTSIDVLCVTASIETLCVIAVDRYFA
ITSPFKYQSLLTKNKARVIILMVWIVSGLTSSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVFCLKEHKALK
TLGIIMGTFTLCWLPFFILNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r4rA00
GIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLC
VTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSSIVSFYVPLVIMVFVYSRVFQEAKRQLQKID
KSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWI
GYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLK
BLAST against CATH

[top]
Domain History Events (105)

Domain assigned by cuff on 08 Jan 2009 16:57

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 16:54

homology match

Homcheck allotment by cuff on 08 Jan 2009 16:52

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 16:52

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 08:59

Domain "2r4rA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 08:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r4rA00

Flow stage update by auto on 05 Nov 2008 08:56

Retrieved PRC_PFAMCATH results for job ID SID7509306208558224 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 08:56

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 2r4rA00

Update comment by auto on 05 Nov 2008 06:00

PRC_PFAMCATH job SID7509306208558224 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 05:59

The entry "2r4rA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 05:59

The entry "2r4rA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 05:46

Retrieved SSAP results for job ID SID9956679356444976 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 05:45

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 455 results for 2r4rA00

Update comment by auto on 03 Nov 2008 17:46

SSAP job SID9956679356444976 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:32

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:32

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:30

Giving up on SSAP job SID4673858208752192 because submission time of Tue Oct 28 12:09:46 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:30:43 2008).

Update comment by auto on 28 Oct 2008 12:29

SSAP job SID4673858208752192 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:09

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:09

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:54

Giving up on SSAP job SID3141175017193792 because submission time of Wed Oct 22 09:21:45 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:54:55 2008).

Update comment by auto on 22 Oct 2008 09:40

SSAP job SID3141175017193792 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:21

The entry "2r4rA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:21

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:16

Giving up on SSAP job SID9044658762423448 because submission time of Thu Oct 16 06:00:57 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:16:57 2008).

Update comment by auto on 16 Oct 2008 06:18

SSAP job SID9044658762423448 is not yet finished.

Flow stage update by auto on 16 Oct 2008 06:00

The entry "2r4rA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 06:00

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:29

Giving up on SSAP job SID5454931063736984 because submission time of Fri Oct 10 02:59:53 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:29:38 2008).

Update comment by auto on 10 Oct 2008 03:38

SSAP job SID5454931063736984 is not yet finished.

Flow stage update by auto on 10 Oct 2008 02:59

The entry "2r4rA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 02:59

The entry "2r4rA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:16

Retrieved PRC results for job ID SID7760106178288192 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:15

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2r4rA00

Update comment by auto on 08 Oct 2008 18:21

PRC job SID7760106178288192 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 18:07

The entry "2r4rA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 18:07

The entry "2r4rA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 17:41

Retrieved HMM(SAM) results for job ID SID5145117313115824 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 17:41

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2r4rA00

Update comment by auto on 03 Oct 2008 21:01

HMM(SAM) job SID5145117313115824 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 20:43

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 20:43

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 17:59

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID1239242732047664"

Update comment by auto on 03 Oct 2008 00:33

HMM(SAM) job SID1239242732047664 is not yet finished.

Flow stage update by auto on 03 Oct 2008 00:09

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 00:09

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 21:03

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID9993994172695424"

Update comment by auto on 02 Oct 2008 18:23

HMM(SAM) job SID9993994172695424 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 18:06

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:06

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 15:10

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID7288824712504832"

Update comment by auto on 02 Oct 2008 09:29

HMM(SAM) job SID7288824712504832 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 09:14

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 09:14

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 03:44

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID5698075203915344"

Update comment by auto on 29 Sep 2008 06:02

HMM(SAM) job SID5698075203915344 is not yet finished.

Sam cath submit by auto on 29 Sep 2008 06:00

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 29 Sep 2008 06:00

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 29 Sep 2008 04:21

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID5789937885205536"

Update comment by auto on 26 Sep 2008 17:51

HMM(SAM) job SID5789937885205536 is not yet finished.

Flow stage update by auto on 26 Sep 2008 17:44

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 26 Sep 2008 17:44

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:50

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID2668440742365344"

Update comment by auto on 26 Sep 2008 12:22

HMM(SAM) job SID2668440742365344 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 12:14

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 12:14

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 09:12

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID1478914754352277"

Update comment by auto on 26 Sep 2008 06:34

HMM(SAM) job SID1478914754352277 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 06:25

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:25

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 03:46

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID5473094606304504"

Update comment by auto on 26 Sep 2008 00:01

HMM(SAM) job SID5473094606304504 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 23:51

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 23:51

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 20:48

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID5233726790996256"

Update comment by auto on 25 Sep 2008 18:00

HMM(SAM) job SID5233726790996256 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 17:50

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 17:50

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 14:54

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID9046510413087968"

Update comment by auto on 25 Sep 2008 12:32

HMM(SAM) job SID9046510413087968 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 12:19

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:19

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:44

Unable to retrieve "2r4rA00" HMM(SAM) results for job "SID7310549774061824"

Update comment by auto on 25 Sep 2008 02:49

HMM(SAM) job SID7310549774061824 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 02:36

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 02:36

The entry "2r4rA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 01:04

Retrieved "2r4rA00" CATHEDRAL results for job ID SID8492671807631942 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 01:03

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 120 results for 2r4rA00

Cathedral cath submit by auto on 25 Sep 2008 00:04

The entry "2r4rA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 25 Sep 2008 00:04

The entry "2r4rA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:40

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2r4rA00.scanlist" for "2r4rA00"

Write scan list by auto on 24 Sep 2008 23:40

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2r4rA00.scanlist" for domain "2r4rA00"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 12:06

Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 08:50

Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 07:12

Waiting for 252 new domains (example : 2raeA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Sep 2008 23:39

Waiting for 283 new domains (example : 2r8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 23 Sep 2008 20:34

Waiting for 343 new domains (example : 2r6vA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 23 Sep 2008 20:33

No satisfactory AssignClose result found.

Flow stage update by auto on 23 Sep 2008 20:15

No in_process hits for Domain "2r4rA00" ready to be processed

Flow stage update by auto on 23 Sep 2008 20:15

NW result present for Domain "2r4rA00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r4rA00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r4rA00"

Insertion by cuff on 22 Sep 2008 11:48

nice chopping