CATH Domain: 2r4qA00 XML data for domain: 2r4qA00

Molscript image for 2r4qA00
2r4qA00
PDB coordinates for domain 2r4qA00

PDB 2r4q, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.2300 Gene3D
3.40.50.2300.77
3.40.50.2300.77.1
3.40.50.2300.77.1.1
3.40.50.2300.77.1.1.1
3.40.50.2300.77.1.1.1.1

[top]
Segment boundaries for domain 2r4qA00

Chopping figure for domain 2r4qA00
DomainStart PDB ResidueStop PDB Residue
2r4qA00 170 273

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.2300.77.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2kyrA00 89.40 PTS system, fructose-specific IIB-like component [EC:2.7.1.69]Escherichia coli K-12Fructose-like phosphotransferase enzyme IIB component 1 3.40.50.2300 108 38 90 3.29 3.63
1g7sA03 76.36 Methanothermobacter thermautotrophicus str. Delta HTranslation initiation factor IF-2 unclassified subunitProbable translation initiation factor IF-2 3.40.50.10050 81 9 64 3.17 4.93
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2r4qA00
AKILAVTACPTGHTFAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAPAIIVAADKQVEERFKGKRVLQVPVTA
GIRRPQELIEKANQDAPIY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2r4qA00
SNAKILAVTACPTGIAHTFXAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAPAIIVAADKQVEXERFKGKRVL
QVPVTAGIRRPQELIEKAXNQDAPIY
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 Feb 2009 18:41

Assigning to "3.40.50.2300" based on similarity with "2r48A00"

Flow stage update by auto on 18 Feb 2009 18:15

No in_process hits for Domain "2r4qA00" ready to be processed

Update comment by auto on 23 Sep 2008 20:17

Domain "2r4qA00" hits Domain "2r48A00" (57.5471698113208% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 20:15

Domain "2r4qA00" hits Domain "2r48A00" (57.5471698113208% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 20:15

NW result present for Domain "2r4qA00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2r4qA00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2r4qA00"

Insertion by auto on 22 Sep 2008 14:04

Final ChopClose added based on similarity with "2r48A"