CATH Domain: 2r4iA00

2r4iA00

PDB 2r4i, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.10	Roll
3.10.450	Nuclear Transport Factor 2; Chain: A,
3.10.450.50		Gene3D
3.10.450.50.14
3.10.450.50.14.1
3.10.450.50.14.1.1
3.10.450.50.14.1.1.1
3.10.450.50.14.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2r4iA00

Domain	Start PDB Residue	Stop PDB Residue
2r4iA00	0	122

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.10.450.50.14.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3bb9B00	84.82	Putative orphan proteinShewanella frigidimarina NCIMB 400	3.10.450.50	120	13	90	2.88	3.17
2owpA00	84.01	Burkholderia xenovorans LB400Putative uncharacterized protein	3.10.450.50	124	13	85	2.79	3.26
2ux0B00	83.44	Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex	3.10.450.50	136	15	82	3.14	3.81
3blzA00	83.22	Shewanella baltica OS155Putative uncharacterized protein	3.10.450.50	123	6	86	2.86	3.29
1tuhA00	82.47	Uncultured bacteriumPutative uncharacterized protein	3.10.450.50	131	14	83	3.13	3.76
1m98A02	82.40	Arthrospira maximaOrange carotenoid-binding protein	3.10.450.50	128	11	86	3.31	3.82
3cnxA00	82.25	Streptomyces avermitilisPutative uncharacterized protein	3.10.450.50	135	12	83	2.90	3.46
3b7cA00	81.82	Shewanella oneidensisPutative uncharacterized protein	3.10.450.50	115	14	91	2.92	3.20
1jkgA00	81.57	CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1	3.10.450.50	139	12	78	2.55	3.25
1of5B00	81.34	Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae	3.10.450.50	128	7	85	2.91	3.39
2rgqB00	78.76		3.10.450.50	124	9	82	3.69	4.49
1q42A00	76.83	MRNA transport regulator MTR2Candida albicans	3.10.450.50	159	10	69	3.37	4.83
1jkgB00	75.02	Nuclear RNA export factor 1Homo sapiensProtein binding	3.10.450.50	180	11	61	2.77	4.49
1of5A00	74.94	Nuclear poreStructural constituent of nuclear poreRNA bindingMRNA export factor MEX67MRNA export from nucleus	3.10.450.50	154	13	71	3.39	4.75
1q40D00	74.28	MRNA export factor MEX67Candida albicans	3.10.450.50	169	7	64	3.02	4.68

[top]
Domain ATOM Sequence

>pdb|2r4iA00
GNQRDVILDCEKKLLTAIQNNDVESLEVLLHDDLLFIIPSGETVTKETDIAAYSSGKIALRAVVPSDYIIRIIHDTVVVS
VNIEIKGEYEHTLDNTFRYLRVWKLFDGNWKVIAGSCTAIG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2r4iA00
GXNQRDVILDCEKKLLTAIQNNDVESLEVLLHDDLLFIIPSGETVTKETDIAAYSSGKIALRAVVPSDYIIRIIHDTVVV
SVNIEIKGEYXEHTLDNTFRYLRVWKLFDGNWKVIAGSCTAIG

BLAST against CATH

[top]
Domain History Events (108)

Domain assigned by cuff on 08 Jan 2009 16:51

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 16:49

homology match

Homcheck allotment by cuff on 08 Jan 2009 16:38

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 16:38

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 04 Nov 2008 11:59

Domain "2r4iA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 04 Nov 2008 11:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r4iA00

Flow stage update by auto on 04 Nov 2008 11:56

Retrieved PRC_PFAMCATH results for job ID SID8234062931350952 and results inserted.

Domain scan prc pfamcath by auto on 04 Nov 2008 11:55

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 25 results for 2r4iA00

Update comment by auto on 04 Nov 2008 09:30

PRC_PFAMCATH job SID8234062931350952 is not yet finished.

Prc pfamcath submit by auto on 04 Nov 2008 09:23

The entry "2r4iA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 04 Nov 2008 09:23

The entry "2r4iA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 04 Nov 2008 09:12

Retrieved SSAP results for job ID SID1081787463140776 and results inserted.

Domain scan ssap cath by auto on 04 Nov 2008 09:10

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2033 results for 2r4iA00

Update comment by auto on 03 Nov 2008 17:46

SSAP job SID1081787463140776 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:33

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:33

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:30

Giving up on SSAP job SID0945690562012224 because submission time of Tue Oct 28 12:09:52 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:30:47 2008).

Update comment by auto on 28 Oct 2008 12:29

SSAP job SID0945690562012224 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:09

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:09

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:55

Giving up on SSAP job SID9591762370473792 because submission time of Wed Oct 22 09:21:59 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:55:01 2008).

Update comment by auto on 22 Oct 2008 09:41

SSAP job SID9591762370473792 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:21

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:21

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:17

Giving up on SSAP job SID1587286142180976 because submission time of Thu Oct 16 06:01:05 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:17:04 2008).

Update comment by auto on 16 Oct 2008 06:18

SSAP job SID1587286142180976 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:01

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:01

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:29

Giving up on SSAP job SID1427154880314654 because submission time of Fri Oct 10 03:00:04 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:29:44 2008).

Update comment by auto on 10 Oct 2008 03:38

SSAP job SID1427154880314654 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:00

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:00

The entry "2r4iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:17

Retrieved PRC results for job ID SID3895186697070885 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:16

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2r4iA00

Update comment by auto on 09 Oct 2008 00:15

PRC job SID3895186697070885 is not yet finished.

Flow stage update by auto on 08 Oct 2008 23:56

The entry "2r4iA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 23:56

The entry "2r4iA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 23:41

Retrieved HMM(SAM) results for job ID SID6049938774299432 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 23:40

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2r4iA00