CATH Domain: 2r3bA01 XML data for domain: 2r3bA01

Molscript image for 2r3bA01
2r3bA01
PDB coordinates for domain 2r3bA01

PDB 2r3b, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1190 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
3.40.1190.20 Gene3D
3.40.1190.20.9
3.40.1190.20.9.1
3.40.1190.20.9.1.1
3.40.1190.20.9.1.1.1
3.40.1190.20.9.1.1.1.1

Segment boundaries for domain 2r3bA01

Chopping figure for domain 2r3bA01
DomainStart PDB ResidueStop PDB Residue
2r3bA01 2 276

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.9.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fv7A00 74.67 Pentose phosphate pathwayRibokinaseRibokinase [EC:2.7.1.15]Homo sapiens 3.40.1190.20 308 12 74 3.67 4.94
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2r3bA01
RYLSKDILEEVITQRPSDSYKSNFGRVVLIGGNRQYGGAIISTEACINSGAGLTTVITDVKNHGPLHARCPEAVVGFEET
VLLTNVVEQADVILIGPGLGLDATAQQILKVLAQHQKQQWLIIDGSAITLFSQGNFSLTYPEKVVFTPHQEWQRLSHLPI
EQQTLANNQRQQAKLGSTIVLKSHRTTIFHAGEPFQNTGGNPGATGGTGDTLAGIIAGFLAQFKPTIETIAGAVYLHSLI
GDDLAKTDYVVLPTKISQALPTYKKYAQP    

Domain COMBS Sequence

>pdb|2r3bA01
RYLSKDILEEVITQRPSDSYKSNFGRVVLIGGNRQYGGAIIXSTEACINSGAGLTTVITDVKNHGPLHARCPEAXVVGFE
ETVLLTNVVEQADVILIGPGLGLDATAQQILKXVLAQHQKQQWLIIDGSAITLFSQGNFSLTYPEKVVFTPHQXEWQRLS
HLPIEQQTLANNQRQQAKLGSTIVLKSHRTTIFHAGEPFQNTGGNPGXATGGTGDTLAGIIAGFLAQFKPTIETIAGAVY
LHSLIGDDLAKTDYVVLPTKISQALPTYXKKYAQPHTAPDSELLEQKRSR    

Domain History Events (9)

Domain assigned by auto on 08 Jan 2009 17:08

Assigning to "3.40.1190.20" based on similarity with "2r3bB01"

Flow stage update by auto on 08 Jan 2009 16:52

No in_process hits for Domain "2r3bA01" ready to be processed

Update comment by auto on 08 Jan 2009 16:35

Domain "2r3bA01" hits Domain "2r3bB01" (97.9310344827586% over 100%) which is currently in process

Update comment by auto on 16 Sep 2008 14:08

Domain "2r3bA01" hits Domain "2r3eA00" (97.9310344827586% over 100%) which is currently in process

Flow stage update by auto on 16 Sep 2008 14:07

Domain "2r3bA01" hits Domain "2r3eA00" (97.9310344827586% over 100%) which is currently in process

Flow stage update by auto on 16 Sep 2008 14:07

NW result present for Domain "2r3bA01"

Flow stage update by auto on 16 Sep 2008 08:09

All required files are present for Domain "2r3bA01"

Flow stage update by auto on 15 Sep 2008 21:40

Beginning processing for Domain "2r3bA01"

Insertion by auto on 15 Sep 2008 20:12

Final ChopClose added based on similarity with "2r3bB"