Domain assigned by auto on 29 Nov 2007 22:09
Assigning to "3.90.190.10" based on similarity with "1m3gA00"
There are 10 matching structural neighberhood comparisons for CATH ID 3.90.190.10.15.1.1.1.1 (SIMAX score < 5)
>pdb|2r0bA00 RREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEF IDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLA
Assigning to "3.90.190.10" based on similarity with "1m3gA00"
No in_process hits for Domain "2r0bA00" ready to be processed
NW result present for Domain "2r0bA00"
All required files are present for Domain "2r0bA00"
Beginning processing for Domain "2r0bA00"
Final ChopClose added based on similarity with "1m3gA"