CATH Domain: 2r01A01

2r01A01

PDB 2r01, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.109	NADH Oxidase
3.40.109.10	NADH Oxidase	Gene3D
3.40.109.10.6
3.40.109.10.6.1
3.40.109.10.6.1.1
3.40.109.10.6.1.1.1
3.40.109.10.6.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2r01A01

Domain	Start PDB Residue	Stop PDB Residue
2r01A01	13	165
2r01A02	166	207

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.109.10.6.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2b67A00	83.09	[EC:1.-.-.-]Nitroreductase family proteinStreptococcus pneumoniae	3.40.109.10	198	18	70	2.20	3.11
2freA00	80.89	NAD(P)H-flavin oxidoreductaseAgrobacterium tumefaciens str. C58	3.40.109.10	195	19	70	2.60	3.67
2h0uA00	80.32	NAD(P)H-flavin oxidoreductase[EC:1.-.-.-]Helicobacter pylori	3.40.109.10	187	14	62	2.09	3.37
1vkwA01	79.44	Thermotoga maritimaPutative uncharacterized protein	3.40.109.10	118	15	69	2.46	3.56
1bkjA00	79.24	Vibrio harveyiNADPH-flavin oxidoreductase	3.40.109.10	230	24	60	2.48	4.10
2hayC00	78.43	[EC:1.-.-.-]NAD(P)H-dependent quinone reductaseStreptococcus pyogenes serotype M1	3.40.109.10	209	12	64	2.41	3.73

[top]
Domain ATOM Sequence

>pdb|2r01A01
KLRELVARSRSIRRFDEHVAVNDATLRDLVELVCYTPSAANRQLLRFLPVTGADSDKVFPCLKWAGYLEDWPGPEPGERP
AAALVLCRNEDLPGAACDSGIAAQTILGAAEKELGGCIVAAIDRERLASLGIPDAWTVLLVIALGKPAE

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2r01A01
GXEGSLSRGVEIXKLRELVARSRSIRRFDEHVAVNDATLRDLVELVCYTPSAANRQLLRFLPVTGADXSDKVFPCLKWAG
YLEDWPGPEPGERPAAALVXLCRNEDLPGAACDSGIAAQTIXLGAAEKELGGCIVAAIDRERLXASLGIPDAWTVLLVIA
LGKPAE

BLAST against CATH

[top]
Domain History Events (79)

Domain assigned by cuff on 08 Jan 2009 14:53

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 14:49

homology match

Homcheck allotment by cuff on 08 Jan 2009 14:44

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 14:44

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 04 Nov 2008 11:58

Domain "2r01A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 04 Nov 2008 11:57

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2r01A01

Flow stage update by auto on 04 Nov 2008 11:53

Retrieved PRC_PFAMCATH results for job ID SID7475662511759344 and results inserted.

Domain scan prc pfamcath by auto on 04 Nov 2008 11:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 2r01A01

Update comment by auto on 04 Nov 2008 09:26

PRC_PFAMCATH job SID7475662511759344 is not yet finished.

Flow stage update by auto on 04 Nov 2008 09:22

The entry "2r01A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 04 Nov 2008 09:22

The entry "2r01A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 04 Nov 2008 08:58

Retrieved SSAP results for job ID SID0487342428472096 and results inserted.

Domain scan ssap cath by auto on 04 Nov 2008 08:56

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1280 results for 2r01A01

Update comment by auto on 03 Nov 2008 17:45

SSAP job SID0487342428472096 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:31

The entry "2r01A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:31

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:29

Giving up on SSAP job SID5477985238044352 because submission time of Tue Oct 28 12:08:25 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:29:46 2008).

Update comment by auto on 28 Oct 2008 12:28

SSAP job SID5477985238044352 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:08

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:08

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:53

Giving up on SSAP job SID0480778463784192 because submission time of Wed Oct 22 09:19:43 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:53:46 2008).

Update comment by auto on 22 Oct 2008 09:40

SSAP job SID0480778463784192 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:19

The entry "2r01A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:19

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:15

Giving up on SSAP job SID8146285467946960 because submission time of Thu Oct 16 05:59:35 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:15:30 2008).

Update comment by auto on 16 Oct 2008 06:17

SSAP job SID8146285467946960 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:59

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:59

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:28

Giving up on SSAP job SID1680723745880960 because submission time of Fri Oct 10 02:57:50 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:28:09 2008).

Update comment by auto on 10 Oct 2008 03:36

SSAP job SID1680723745880960 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:57

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:57

The entry "2r01A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 01:05

Retrieved PRC results for job ID SID8040422957529424 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 12 results for 2r01A01

Update comment by auto on 09 Oct 2008 00:14

PRC job SID8040422957529424 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 23:54

The entry "2r01A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 23:54

The entry "2r01A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 23:35

Retrieved HMM(SAM) results for job ID SID5761317690026820 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 23:35

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 12 results for 2r01A01