CATH Domain: 2qzuA01

2qzuA01

PDB 2qzu, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.720	Alkaline Phosphatase, subunit A
3.40.720.10	Alkaline Phosphatase, subunit A	Gene3D
3.40.720.10.4
3.40.720.10.4.1
3.40.720.10.4.1.1
3.40.720.10.4.1.1.1
3.40.720.10.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qzuA01

Domain	Start PDB Residue	Stop PDB Residue
2qzuA01	28	392
2qzuA02	398	482

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.720.10.4.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1fsuA01	83.47	LysosomeArylsulfatase B [EC:3.1.6.12]Glycosaminoglycan degradationMetabolic pathwaysLysosomal transport	3.40.720.10	370	21	81	2.53	3.12
	1aukA01	81.62	Calcium ion bindingLysosomeArylsulfatase A [EC:3.1.6.8]Arylsulfatase ALysosome	3.40.720.10	383	21	77	2.94	3.80

[top]
Domain ATOM Sequence

>pdb|2qzuA01
PNLVFIADQYRGDAIGCIGKEPVKTPHLDKLASEGINFTNAISSYPVSSPARGLTGYPIGSKVTGNCNSETAPYGVELSQ
NARCWSDVLKDQGYNGYIGKWHLDAPYKPYVDTYNNRGKVAWNEWCPPERRHGFDHWIAYGTYDYHLKPYWNTTAPRDSF
YYVNQWGPEYEASKAIEYINGQKDQKQPFALVVSNPPHTGYELVPDRYKEIYKDLDVEALCKGRPDIPAKGTEGDYFRNN
IRNYYACITGVDENVGRIIEALKQNNLFDNTIVVFTSDHGICGAHENAGKDIFYEESRIPILSWPDQIKPRKSDPLIAFA
DLYPTLLSGFSKEIPETVQTFDLSNEVLTGK

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qzuA01
PNLVFIXADQYRGDAIGCIGKEPVKTPHLDKLASEGINFTNAISSYPVSSPARGXLXTGXYPIGSKVTGNCNSETAPYGV
ELSQNARCWSDVLKDQGYNXGYIGKWHLDAPYKPYVDTYNNRGKVAWNEWCPPERRHGFDHWIAYGTYDYHLKPXYWNTT
APRDSFYYVNQWGPEYEASKAIEYINGQKDQKQPFALVVSXNPPHTGYELVPDRYKEIYKDLDVEALCKGRPDIPAKGTE
XGDYFRNNIRNYYACITGVDENVGRIIEALKQNNLFDNTIVVFTSDHGICXGAHENAGKDIFYEESXRIPXILSWPDQIK
PRKSDPLXIAFADLYPTLLSXXGFSKEIPETVQTFDLSNEVLTGK

BLAST against CATH

[top]
Domain History Events (75)

Domain assigned by cuff on 08 Jan 2009 14:40

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 14:38

homology match

Homcheck allotment by cuff on 08 Jan 2009 14:28

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 14:28

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 09:47

Domain "2qzuA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 09:47

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qzuA01

Flow stage update by auto on 06 Nov 2008 09:44

Retrieved PRC_PFAMCATH results for job ID SID8793092563211560 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 09:44

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 46 results for 2qzuA01

Update comment by auto on 06 Nov 2008 06:45

PRC_PFAMCATH job SID8793092563211560 is not yet finished.

Prc pfamcath submit by auto on 06 Nov 2008 06:41

The entry "2qzuA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 06:41

The entry "2qzuA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 05:55

Retrieved SSAP results for job ID SID8692465246411456 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 05:54

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 9 results for 2qzuA01