CATH Domain: 2qzcA00 XML data for domain: 2qzcA00

Molscript image for 2qzcA00
2qzcA00
PDB coordinates for domain 2qzcA00

PDB 2qzc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.5
1.20.910.10.5.1
1.20.910.10.5.1.1
1.20.910.10.5.1.1.1
1.20.910.10.5.1.1.1.1

[top]
Segment boundaries for domain 2qzcA00

Chopping figure for domain 2qzcA00
DomainStart PDB ResidueStop PDB Residue
2qzcA00 3 213

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.20.910.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1uddA00 86.05 Thiamine metabolismPyrococcus horikoshiiTranscriptional activator TenA [EC:3.5.99.2]218aa long hypothetical transcriptional regulator 1.20.910.10 215 28 85 2.41 2.83
1rtwB00 83.80 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 17 85 2.62 3.05
2f2gA00 80.99 Seed maturation protein PM36 homologArabidopsis thaliana 1.20.910.10 211 12 81 2.89 3.52
1rcwB00 80.50 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 10 83 3.31 3.95
1j02A00 79.72 DNA damage response, signal transduction resulting in induction of apoptosisRattus norvegicusRegulation of blood pressureNucleolusResponse to hydrogen peroxide 1.20.910.10 212 7 83 3.93 4.71
2qcxA00 79.56 Thiamine metabolismBacillus subtilisThiaminase-2Transcriptional activator TenA [EC:3.5.99.2] 1.20.910.10 222 18 81 3.63 4.45
1sk7A00 75.47 Pseudomonas aeruginosaHeme oxygenaseHeme oxygenase 1.20.910.10 187 6 88 4.22 4.75
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qzcA00
IVGNVENLINGVGELWNKYVKHEFILKRDGSLPLDIFRYYLIQDGKYVEDLRALLIASSKGPIDKVTKILNLVFSSKGLE
THGKLYSKLDISRDVIVKTGYNLINYAYTRHLYYYANLDWNKFLVAWTPCFGYSIVGDYVIDSPNEVYKTWASFYASTEY
KKRIEAILYALDEVSITEDLLNIFINSVRFEIGFWDASLRKDPTVY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qzcA00
GXSIVGNVENLINGVGELWNKYVKHEFILKXRDGSLPLDIFRYYLIQDGKYVEDXLRALLIASSKGPIDKVTKILNLVFS
SRDKGLETHGKLYSKLDISRDVIVKTGYNLINYAYTRHLYYYANLDWNKFLVAWTPCXFGYSIVGDYVIDSPNEVYKTWA
SFYASTEYKKRIEAILYALDEVSITEDLLNIFINSVRFEIGFWDASLRKDPTVY
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 08 Jan 2009 15:04

Assigning to "1.20.910.10" based on similarity with "2qzcB00"

Flow stage update by auto on 08 Jan 2009 14:43

No in_process hits for Domain "2qzcA00" ready to be processed

Update comment by auto on 14 Sep 2008 23:08

Domain "2qzcA00" hits Domain "2qzcB00" (98.1308411214953% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 23:07

Domain "2qzcA00" hits Domain "2qzcB00" (98.1308411214953% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 23:07

NW result present for Domain "2qzcA00"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qzcA00"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qzcA00"

Insertion by auto on 10 Sep 2008 15:15

Final ChopClose added based on similarity with "2qzcB"