CATH Domain: 2qytA02 XML data for domain: 2qytA02

Molscript image for 2qytA02
2qytA02
PDB coordinates for domain 2qytA02

PDB 2qyt, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1040 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2
1.10.1040.10 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 Gene3D
1.10.1040.10.13
1.10.1040.10.13.1
1.10.1040.10.13.1.1
1.10.1040.10.13.1.1.1
1.10.1040.10.13.1.1.1.1

[top]
Segment boundaries for domain 2qytA02

Chopping figure for domain 2qytA02
DomainStart PDB ResidueStop PDB Residue
2qytA01 4 189
2qytA02 190 310

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2qytA02
DIDWYIKKFISVTATATAYFDKPIGSILTEHEPELLSLLEEVAELFRAKYGQVPDDVVQQLLDKQRKETLTGYVVREAEA
LRVDLPYKRYRELVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qytA02
DIDWYIXKKFXXISVTATATAYFDKPIGSILTEHEPELLSLLEEVAELFRAKYGQVPDDVVQQLLDKQRKXPPESTSSXH
SDFLQGGSTEVETLTGYVVREAEALRVDLPXYKRXYRELVSRTAN
BLAST against CATH

[top]
Domain History Events (88)

Domain assigned by cuff on 08 Jan 2009 14:02

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 14:00

homology match

Homcheck allotment by cuff on 08 Jan 2009 13:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 13:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 04 Nov 2008 09:31

Domain "2qytA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 04 Nov 2008 09:30

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qytA02

Flow stage update by auto on 04 Nov 2008 09:25

Retrieved PRC_PFAMCATH results for job ID SID5751335994451160 and results inserted.

Domain scan prc pfamcath by auto on 04 Nov 2008 09:24

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 2qytA02

Update comment by auto on 04 Nov 2008 06:42

PRC_PFAMCATH job SID5751335994451160 is not yet finished.

Flow stage update by auto on 04 Nov 2008 06:40

The entry "2qytA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 04 Nov 2008 06:40

The entry "2qytA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 04 Nov 2008 03:20

Retrieved SSAP results for job ID SID3117254679790112 and results inserted.

Domain scan ssap cath by auto on 04 Nov 2008 03:08

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3040 results for 2qytA02

Update comment by auto on 03 Nov 2008 17:44

SSAP job SID3117254679790112 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:30

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:30

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:29

Giving up on SSAP job SID9309098354692512 because submission time of Tue Oct 28 12:07:39 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:29:14 2008).

Update comment by auto on 28 Oct 2008 12:27

SSAP job SID9309098354692512 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:07

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:07

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:53

Giving up on SSAP job SID5122838335776616 because submission time of Wed Oct 22 09:18:38 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:53:07 2008).

Update comment by auto on 22 Oct 2008 09:39

SSAP job SID5122838335776616 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:18

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:18

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:14

Giving up on SSAP job SID6094230246912080 because submission time of Thu Oct 16 05:58:49 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:14:41 2008).

Update comment by auto on 16 Oct 2008 06:16

SSAP job SID6094230246912080 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:58

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:58

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:27

Giving up on SSAP job SID2836132767953296 because submission time of Fri Oct 10 02:56:38 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:27:15 2008).

Update comment by auto on 10 Oct 2008 03:35

SSAP job SID2836132767953296 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:56

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:56

The entry "2qytA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:56

Retrieved PRC results for job ID SID5809414002114886 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:55

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2qytA02

Update comment by auto on 08 Oct 2008 21:27

PRC job SID5809414002114886 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:15

The entry "2qytA02" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:15

The entry "2qytA02" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:59

Retrieved HMM(SAM) results for job ID SID4143520276153552 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:59

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2qytA02

Update comment by auto on 04 Oct 2008 12:48

HMM(SAM) job SID4143520276153552 is not yet finished.

Sam cath submit by auto on 04 Oct 2008 12:34

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 12:34

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 09:45

Unable to retrieve "2qytA02" HMM(SAM) results for job "SID1769694425357856"

Update comment by auto on 03 Oct 2008 03:50

HMM(SAM) job SID1769694425357856 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 03:27

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 03:27

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:30

Unable to retrieve "2qytA02" HMM(SAM) results for job "SID3064912551709936"

Update comment by auto on 02 Oct 2008 21:01

HMM(SAM) job SID3064912551709936 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:40

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:40

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:21

Unable to retrieve "2qytA02" HMM(SAM) results for job "SID5318089966217776"

Update comment by auto on 02 Oct 2008 15:08

HMM(SAM) job SID5318089966217776 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:48

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:48

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:06

Unable to retrieve "2qytA02" HMM(SAM) results for job "SID2513078548405568"

Update comment by auto on 02 Oct 2008 03:42

HMM(SAM) job SID2513078548405568 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 03:13

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 03:13

The entry "2qytA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 02:09

Retrieved "2qytA02" CATHEDRAL results for job ID SID1797756963366834 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 02:08

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 137 results for 2qytA02

Update comment by auto on 29 Sep 2008 04:14

"2qytA02" CATHEDRAL job SID1797756963366834 is not yet finished.

Cathedral cath submit by auto on 29 Sep 2008 04:00

The entry "2qytA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 29 Sep 2008 04:00

The entry "2qytA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:42

Giving up on "2qytA02" CATHEDRAL job SID9659208769155310 because submission time of Mon Sep 22 18:59:32 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:42:40 2008).

Update comment by auto on 22 Sep 2008 19:11

"2qytA02" CATHEDRAL job SID9659208769155310 is not yet finished.

Cathedral cath submit by auto on 22 Sep 2008 18:59

The entry "2qytA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 18:59

The entry "2qytA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:34

Giving up on "2qytA02" CATHEDRAL job SID1111461555697344 because submission time of Tue Sep 16 15:01:04 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:34:51 2008).

Update comment by auto on 16 Sep 2008 15:13

"2qytA02" CATHEDRAL job SID1111461555697344 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 15:01

The entry "2qytA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 15:01

The entry "2qytA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:42

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qytA02.scanlist" for "2qytA02"

Write scan list by auto on 16 Sep 2008 14:41

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qytA02.scanlist" for domain "2qytA02"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:29

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 10:00

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:24

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 20:34

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 20:13

No in_process hits for Domain "2qytA02" ready to be processed

Flow stage update by auto on 14 Sep 2008 20:13

NW result present for Domain "2qytA02"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qytA02"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qytA02"

Insertion by cuff on 10 Sep 2008 15:10

nice chopping