CATH Domain: 2qybA00

2qybA00

PDB 2qyb, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.450	Beta-Lactamase
3.30.450.40		Gene3D
3.30.450.40.16
3.30.450.40.16.1
3.30.450.40.16.1.1
3.30.450.40.16.1.1.1
3.30.450.40.16.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qybA00

Domain	Start PDB Residue	Stop PDB Residue
2qybA00	7	157

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|2qybA00
SEINRTLDLQIIDDLLNLLLKEFKLDLAVIRLVDEKGVLRVRSYSGKGIAGIAGKDWEPEIETYIGEAFLSNRLQFVNDT
QYTKPLTRELQKEGIKSFAHIPISRKGEPPFGILSVFSRTIVGLFNEPFLNLLESLAGQLAQAVKIV

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qybA00
SNAVRLRASEIXNRTLDLQIIXDDLLNLLLKEFKLDLAVIRLVDEKGVLRVRSYSGKGIAGIAGKDWEPEIETYIGEAFL
SNRLQFVNDTQYXTKPLTRELXQKEGIKSFAHIPISRKGEPPFGILSVFSRTIVGLFNEPFLNLLESLAGQLAQAVKIV

BLAST against CATH

[top]
Domain History Events (84)

Domain assigned by cuff on 08 Jan 2009 13:42

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 13:37

homology match

Homcheck allotment by cuff on 08 Jan 2009 13:36

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 13:36

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 03 Nov 2008 11:42

Domain "2qybA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 03 Nov 2008 11:42

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qybA00

Flow stage update by auto on 03 Nov 2008 11:39

Retrieved PRC_PFAMCATH results for job ID SID8404022843302132 and results inserted.

Domain scan prc pfamcath by auto on 03 Nov 2008 11:39

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 2qybA00

Update comment by auto on 03 Nov 2008 06:12

PRC_PFAMCATH job SID8404022843302132 is not yet finished.

Prc pfamcath submit by auto on 03 Nov 2008 06:10

The entry "2qybA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 03 Nov 2008 06:10

The entry "2qybA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 03 Nov 2008 05:52

Retrieved SSAP results for job ID SID9332303616245830 and results inserted.

Domain scan ssap cath by auto on 03 Nov 2008 05:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2007 results for 2qybA00

Update comment by auto on 28 Oct 2008 12:26

SSAP job SID9332303616245830 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:06

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:06

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:52

Giving up on SSAP job SID9911081646858880 because submission time of Wed Oct 22 09:17:40 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:52:33 2008).

Update comment by auto on 22 Oct 2008 09:38

SSAP job SID9911081646858880 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:17

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:17

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:13

Giving up on SSAP job SID2249278616210256 because submission time of Thu Oct 16 05:58:04 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:13:53 2008).

Update comment by auto on 16 Oct 2008 06:16

SSAP job SID2249278616210256 is not yet finished.

Flow stage update by auto on 16 Oct 2008 05:58

The entry "2qybA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 05:58

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:26

Giving up on SSAP job SID8326222352821768 because submission time of Fri Oct 10 02:55:32 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:26:26 2008).

Update comment by auto on 10 Oct 2008 03:34

SSAP job SID8326222352821768 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:55

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:55

The entry "2qybA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:51

Retrieved PRC results for job ID SID1537168170633050 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:51

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2qybA00

Update comment by auto on 08 Oct 2008 21:27

PRC job SID1537168170633050 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:13

The entry "2qybA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:13

The entry "2qybA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:56

Retrieved HMM(SAM) results for job ID SID1276574114811310 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:56

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2qybA00