CATH Domain: 2qxlB01 XML data for domain: 2qxlB01

Molscript image for 2qxlB01
2qxlB01
PDB coordinates for domain 2qxlB01

PDB 2qxl, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.19
3.30.420.40.19.1
3.30.420.40.19.1.1
3.30.420.40.19.1.1.1
3.30.420.40.19.1.1.1.1

[top]
Segment boundaries for domain 2qxlB01

Chopping figure for domain 2qxlB01
DomainStart PDB ResidueStop PDB Residue
2qxlB01 3 38
2qxlB01 115 186
2qxlB01 364 389
2qxlB02 39 114
2qxlB03 187 232
2qxlB03 317 363
2qxlB04 233 316
2qxlB05 390 541
2qxlB06 542 652

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.420.40.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3h1qA01 83.37 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 19 76 2.81 3.65
2hoeA02 83.10 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 13 84 3.93 4.66
1huxA01 82.79 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 9 82 3.76 4.54
1sz2B01 78.27 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismGlycolysis / Gluconeogenesis 3.30.420.40 118 15 79 3.76 4.71
1e4fT04 72.86 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 15 58 2.89 4.90
3h1qA02 71.61 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 10 58 2.86 4.91
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qxlB01
TPFGLDLGNNNSVLAVARNRGIDIVVNEVSNRSTPSATQLAAMFIDKVKDTVKQDTKANITDVCIAVPPWYTEEQRYNIA
DAARIAGLNPVRIVNDVTAAGVSYGIFKTTLNQDEAIAKGAAFICAIHSPTLRV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qxlB01
STPFGLDLGNNNSVLAVARNRGIDIVVNEVSNRSTPSATQLAAMFIDKVKDTVKQDTKANITDVCIAVPPWYTEEQRYNI
ADAARIAGLNPVRIVNDVTAAGVSYGIFKTTLNQDEAIAKGAAFICAIHSPTLRV
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 02 Dec 2008 14:26

Assigning to "3.30.420.40" based on similarity with "1qqmA01"

Flow stage update by auto on 02 Dec 2008 14:08

No in_process hits for Domain "2qxlB01" ready to be processed

Flow stage update by auto on 02 Dec 2008 14:08

NW result present for Domain "2qxlB01"

Flow stage update by auto on 02 Dec 2008 11:07

All required files are present for Domain "2qxlB01"

Flow stage update by auto on 01 Dec 2008 17:53

Beginning processing for Domain "2qxlB01"

Insertion by cuff on 01 Dec 2008 16:15

nice chopping