CATH Domain: 2qwvA00

2qwvA00

PDB 2qwv, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.1280	Alpha/beta knot
3.40.1280.10		Gene3D
3.40.1280.10.17
3.40.1280.10.17.1
3.40.1280.10.17.1.1
3.40.1280.10.17.1.1.1
3.40.1280.10.17.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qwvA00

Domain	Start PDB Residue	Stop PDB Residue
2qwvA00	4	205

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|2qwvA00
TRSFILRARSAPTDSQRLLDEIGGKCHTEILAHCNSLFTAQSHREDVVIHLVLESTRDYSRTITVEANEIGFHEAALIAL
LVKALDASVGGKEQTRVVQPGLTVRTISFEALLGELAEHHSLYDKKGDSIRDIKIGPNPCFILTDSKRLGVEKISLGPKL
FASQCVTLIHNEIDHQEAGW

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qwvA00
SNAXRNTXRSFILRARSAPTDSQRLLDEIGGKCHTEILAHCXXNSLFTAQSHREDVVIHLVLESTRDYSRTITVEANEIS
DVGGFHEAALIALLVKALDASVGXGKEQTRVVQPGLTVRTISFEALLGELAEHHSLYXXDKKGDSIRDIKIGPNPCFILT
DHIPXPKKSGNSXKRLGVEKISLGPKXLFASQCVTLIHNEIDHQEAGW

BLAST against CATH

[top]
Domain History Events (76)

Domain assigned by cuff on 08 Jan 2009 13:01

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 13:00

homology match

Homcheck allotment by cuff on 08 Jan 2009 12:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 12:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 03 Nov 2008 09:17

Domain "2qwvA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 03 Nov 2008 09:17

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qwvA00

Flow stage update by auto on 03 Nov 2008 09:14

Retrieved PRC_PFAMCATH results for job ID SID9321070341106256 and results inserted.

Domain scan prc pfamcath by auto on 03 Nov 2008 09:14

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 2qwvA00

Update comment by auto on 03 Nov 2008 02:26

PRC_PFAMCATH job SID9321070341106256 is not yet finished.

Flow stage update by auto on 03 Nov 2008 02:26

The entry "2qwvA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 03 Nov 2008 02:25

The entry "2qwvA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 03 Nov 2008 01:56

Retrieved SSAP results for job ID SID1098313057201592 and results inserted.

Domain scan ssap cath by auto on 03 Nov 2008 01:52

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1018 results for 2qwvA00

Update comment by auto on 28 Oct 2008 12:26

SSAP job SID1098313057201592 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:06

The entry "2qwvA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:06

The entry "2qwvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:52

Giving up on SSAP job SID3529625962577232 because submission time of Wed Oct 22 09:17:01 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:52:07 2008).

Update comment by auto on 22 Oct 2008 09:38

SSAP job SID3529625962577232 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:17

The entry "2qwvA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:17

The entry "2qwvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:13

Giving up on SSAP job SID7505654580974680 because submission time of Thu Oct 16 05:57:29 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:13:17 2008).

Update comment by auto on 16 Oct 2008 06:15

SSAP job SID7505654580974680 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:57

The entry "2qwvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:57

The entry "2qwvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:25

Giving up on SSAP job SID9690481734707952 because submission time of Fri Oct 10 02:54:45 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:25:45 2008).

Update comment by auto on 10 Oct 2008 03:34

SSAP job SID9690481734707952 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:54

The entry "2qwvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:54

The entry "2qwvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:47

Retrieved PRC results for job ID SID1865293364687864 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:46

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 2qwvA00

Update comment by auto on 08 Oct 2008 21:26

PRC job SID1865293364687864 is not yet finished.

Flow stage update by auto on 08 Oct 2008 21:13

The entry "2qwvA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 21:13

The entry "2qwvA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:54

Retrieved HMM(SAM) results for job ID SID8423245617766073 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2qwvA00