CATH Domain: 2qwoB00 XML data for domain: 2qwoB00

Molscript image for 2qwoB00
2qwoB00
PDB coordinates for domain 2qwoB00

PDB 2qwo, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.287 Helix Hairpins
1.10.287.110 Gene3D
1.10.287.110.1
1.10.287.110.1.1
1.10.287.110.1.1.1
1.10.287.110.1.1.1.1
1.10.287.110.1.1.1.1.1

[top]
Segment boundaries for domain 2qwoB00

Chopping figure for domain 2qwoB00
DomainStart PDB ResidueStop PDB Residue
2qwoB00 813 904

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.287.110.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1n4cA01 85.76 DnaJ homolog subfamily C member 6Putative tyrosine-protein phosphatase auxilinBos taurusEndocytosis 1.10.287.110 129 98 71 1.16 1.63
1skvA00 77.09 Protein D-63Sulfolobus virus 1 1.10.287.660 62 3 50 1.92 3.84
1r73A00 76.24 RibosomeThermotoga maritimaLarge subunit ribosomal protein L2950S ribosomal protein L29 1.10.287.310 66 10 58 2.77 4.72
1nt2B02 76.05 Archaeoglobus fulgidusProtein bindingPutative uncharacterized protein 1.10.287.660 67 4 51 2.26 4.42
2oyqA04 75.47 DNA polymeraseEnterobacteria phage RB69 1.10.287.690 49 2 50 2.05 4.10
1o9gA02 74.19 RRNA methyltransferase AviRaStreptomyces viridochromogenes 1.10.287.540 43 2 43 2.11 4.85
3csxA00 74.07 Cyanothece sp. ATCC 51142DUF683-containing protein 1.10.287.660 61 6 43 2.00 4.60
2p5oA04 73.46 DNA polymeraseEnterobacteria phage RB69 1.10.287.690 55 5 51 2.49 4.87
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qwoB00
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFM
ELNDAWSEFENQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qwoB00
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFM
ELNDAWSEFENQ
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 11 Mar 2009 21:14

Assigning to "1.10.287.110" based on similarity with "2qwpB00"

Flow stage update by auto on 11 Mar 2009 21:12

No in_process hits for Domain "2qwoB00" ready to be processed

Update comment by auto on 11 Mar 2009 20:59

Domain "2qwoB00" hits Domain "2qwpB00" (100% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 18:01

Domain "2qwoB00" hits Domain "1n4cA01" (98.9130434782609% over 71.3178294573643%) which is currently in process

Update comment by auto on 22 Dec 2007 17:16

Domain "2qwoB00" hits Domain "1n4cA01" (98.9130434782609% over 71.3178294573643%) which is currently in process

Flow stage update by auto on 22 Dec 2007 17:04

Domain "2qwoB00" hits Domain "1n4cA01" (98.9130434782609% over 71.3178294573643%) which is currently in process

Flow stage update by auto on 22 Dec 2007 17:04

NW result present for Domain "2qwoB00"

Flow stage update by auto on 22 Dec 2007 08:05

All required files are present for Domain "2qwoB00"

Flow stage update by auto on 21 Dec 2007 11:39

Beginning processing for Domain "2qwoB00"

Insertion by auto on 21 Dec 2007 11:06

Final ChopClose added based on similarity with "2qwqB"