CATH Domain: 2qw5A00

2qw5A00

PDB 2qw5, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.20	Alpha-Beta Barrel
3.20.20	TIM Barrel
3.20.20.150	Divalent-metal-dependent TIM barrel enzymes	Gene3D
3.20.20.150.4
3.20.20.150.4.1
3.20.20.150.4.1.1
3.20.20.150.4.1.1.1
3.20.20.150.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qw5A00

Domain	Start PDB Residue	Stop PDB Residue
2qw5A00	6	332

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.20.20.150.4.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1i60A00	77.64	Inosose isomerase [EC:5.3.99.-]Bacillus subtilisInosose isomerase	3.20.20.150	272	16	80	3.93	4.89
	1k77A00	77.44	Protein ygbMProtein bindingEscherichia coli K-12	3.20.20.150	256	11	76	3.21	4.21

[top]
Domain ATOM Sequence

>pdb|2qw5A00
ATSDIYISFFFTTNLQPDNLDYRRIVVAHIKKLQRFGYSGFEFPIAPGLPENYAQDLENYTNLRHYLDSEGLENVKISTN
VGATRTFDPSSNYPEQRQEALEYLKSRVDITAALGGEIGPIVIPYGVFPTTDFNEPIWSDELQEHLKVRYANAQPILDKL
GEYAEIKKVKLAIEPITHWETPGPNKLSQLIEFLKGVKSKQVGVVIDSAHEILDGEGPEIFKTQVEYLAQQGRLHYVQVS
PPDRGALHTSWLPWKSFLTPIVKVYDGPIAVEIFNAIPAFTNSLRLTRRKFWIPDEDPPNQYPNAYDIADEAIKVTRKEL
KKIG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qw5A00
GXTKLPATSDIYISFFXFTTNLQPDNLDYRRIVVAHIKKLQRFGYSGFEFPIAPGLPENYAQDLENYTNLRHYLDSEGLE
NVKISTNVGATRTFDPSSNYPEQRQEALEYLKSRVDITAALGGEIXXGPIVIPYGVFPTTDFNEPIWSDELQEHLKVRYA
NAQPILDKLGEYAEIKKVKLAIEPITHWETPGPNKLSQLIEFLKGVKSKQVGVVIDSAHEILDGEGPEIFKTQVEYLAQQ
GRLHYVQVSPPDRGALHTSWLPWKSFLTPIVKVYDGPIAVEIFNAIPAFTNSLRLTRRKFWIPDEDPPNQYPNAYDIADE
AIKVTRKELKKIGSK

BLAST against CATH

[top]
Domain History Events (90)

Domain assigned by cuff on 08 Jan 2009 12:28

same superfamily

Domain assignment manual match h by cuff on 08 Jan 2009 12:27

homology match

Homcheck allotment by cuff on 08 Jan 2009 12:26

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 12:26

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 15:04

Domain "2qw5A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 15:03

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qw5A00

Flow stage update by auto on 06 Nov 2008 15:02

Retrieved PRC_PFAMCATH results for job ID SID4286117773064304 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 15:01

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 24 results for 2qw5A00

Update comment by auto on 06 Nov 2008 11:58

PRC_PFAMCATH job SID4286117773064304 is not yet finished.

Prc pfamcath submit by auto on 06 Nov 2008 11:56

The entry "2qw5A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 11:56

The entry "2qw5A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 11:39

Retrieved SSAP results for job ID SID7951337625069984 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 11:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 334 results for 2qw5A00

Update comment by auto on 03 Nov 2008 17:44

SSAP job SID7951337625069984 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:30

The entry "2qw5A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:30

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:28

Giving up on SSAP job SID6920306888145184 because submission time of Tue Oct 28 12:06:06 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:28:44 2008).

Update comment by auto on 28 Oct 2008 12:25

SSAP job SID6920306888145184 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:06

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:06

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:51

Giving up on SSAP job SID9469187580095376 because submission time of Wed Oct 22 09:16:48 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:51:59 2008).

Update comment by auto on 22 Oct 2008 09:38

SSAP job SID9469187580095376 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:16

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:16

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:13

Giving up on SSAP job SID8058409422738936 because submission time of Thu Oct 16 05:57:17 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:13:06 2008).

Update comment by auto on 16 Oct 2008 06:15

SSAP job SID8058409422738936 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:57

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:57

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:25

Giving up on SSAP job SID6886972656258300 because submission time of Fri Oct 10 02:54:28 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:25:32 2008).

Update comment by auto on 10 Oct 2008 03:33

SSAP job SID6886972656258300 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:54

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:54

The entry "2qw5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:45

Retrieved PRC results for job ID SID2207019812330652 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:45

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2qw5A00

Update comment by auto on 08 Oct 2008 15:23

PRC job SID2207019812330652 is not yet finished.

Flow stage update by auto on 08 Oct 2008 15:14

The entry "2qw5A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 15:14

The entry "2qw5A00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 14:56

Retrieved HMM(SAM) results for job ID SID3813934391465984 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 14:55

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 2qw5A00