CATH Domain: 2qv5A01

2qv5A01

PDB 2qv5, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.20	Alpha-Beta Barrel
3.20.20	TIM Barrel
3.20.20.370	Glycoside hydrolase/deacetylase	Gene3D
3.20.20.370.2
3.20.20.370.2.1
3.20.20.370.2.1.1
3.20.20.370.2.1.1.1
3.20.20.370.2.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qv5A01

Domain	Start PDB Residue	Stop PDB Residue
2qv5A01	160	393

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.20.20.370.2.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2nlyA00	87.10	Hypothetical proteinBH1492 proteinBacillus halodurans	3.20.20.370	216	18	90	1.66	1.84
	2i5iA00	75.58	Hypothetical proteinEnterococcus faecalisUPF0249 protein EF_3048	3.20.20.370	254	6	80	3.56	4.43

[top]
Domain ATOM Sequence

>pdb|2qv5A01
RPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYP
GTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAK
AISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qv5A01
RPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYP
GTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAK
AISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALVSGQAGE
GHHHHHH

BLAST against CATH

[top]
Domain History Events (84)

Domain assigned by cuff on 10 Mar 2009 17:49

same superfamily

Domain assignment manual match h by cuff on 05 Mar 2009 18:03

homology match

Homcheck allotment by cuff on 08 Jan 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Nov 2008 20:55

Domain "2qv5A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Nov 2008 20:54

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qv5A01

Flow stage update by auto on 02 Nov 2008 20:53

Retrieved PRC_PFAMCATH results for job ID SID6890474958257632 and results inserted.

Domain scan prc pfamcath by auto on 02 Nov 2008 20:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 2qv5A01

Update comment by auto on 02 Nov 2008 17:44

PRC_PFAMCATH job SID6890474958257632 is not yet finished.

Flow stage update by auto on 02 Nov 2008 17:43

The entry "2qv5A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 02 Nov 2008 17:43

The entry "2qv5A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Nov 2008 17:25

Retrieved SSAP results for job ID SID3745238185244800 and results inserted.

Domain scan ssap cath by auto on 02 Nov 2008 17:22

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 850 results for 2qv5A01

Update comment by auto on 28 Oct 2008 12:25

SSAP job SID3745238185244800 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:05

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:05

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:51

Giving up on SSAP job SID4859877816870720 because submission time of Wed Oct 22 09:16:13 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:51:37 2008).

Update comment by auto on 22 Oct 2008 09:38

SSAP job SID4859877816870720 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:16

The entry "2qv5A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:16

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:12

Giving up on SSAP job SID9051650140464868 because submission time of Thu Oct 16 05:56:48 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:12:41 2008).

Update comment by auto on 16 Oct 2008 06:15

SSAP job SID9051650140464868 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:56

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:56

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:24

Giving up on SSAP job SID1124077590882568 because submission time of Fri Oct 10 02:53:47 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:24:56 2008).

Update comment by auto on 10 Oct 2008 03:33

SSAP job SID1124077590882568 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:53

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:53

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:40

Retrieved PRC results for job ID SID2986244325618598 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:39

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2qv5A01

Update comment by auto on 08 Oct 2008 21:26

PRC job SID2986244325618598 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:12

The entry "2qv5A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:12

The entry "2qv5A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:52

Retrieved HMM(SAM) results for job ID SID8535255751226336 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2qv5A01