CATH Domain: 2qv5A01 XML data for domain: 2qv5A01

Molscript image for 2qv5A01
2qv5A01
PDB coordinates for domain 2qv5A01

PDB 2qv5, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.370 Glycoside hydrolase/deacetylase Gene3D
3.20.20.370.4
3.20.20.370.4.1
3.20.20.370.4.1.1
3.20.20.370.4.1.1.1
3.20.20.370.4.1.1.1.1

Segment boundaries for domain 2qv5A01

Chopping figure for domain 2qv5A01
DomainStart PDB ResidueStop PDB Residue
2qv5A01 160 393

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.20.20.370.4.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nlyA00 87.10 Hypothetical proteinBH1492 proteinBacillus halodurans 3.20.20.370 216 18 90 1.66 1.84
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2qv5A01
RPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYP
GTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAK
AISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV    

Domain COMBS Sequence

>pdb|2qv5A01
RPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYP
GTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAK
AISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALVSGQAGE
GHHHHHH    

Domain History Events (84)

Domain assigned by cuff on 10 Mar 2009 17:49

same superfamily

Domain assignment manual match h by cuff on 05 Mar 2009 18:03

homology match

Homcheck allotment by cuff on 08 Jan 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 08 Jan 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Nov 2008 20:55

Domain "2qv5A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Nov 2008 20:54

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qv5A01

Flow stage update by auto on 02 Nov 2008 20:53

Retrieved PRC_PFAMCATH results for job ID SID6890474958257632 and results inserted.

Domain scan prc pfamcath by auto on 02 Nov 2008 20:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 2qv5A01

Update comment by auto on 02 Nov 2008 17:44

PRC_PFAMCATH job SID6890474958257632 is not yet finished.

Flow stage update by auto on 02 Nov 2008 17:43

The entry "2qv5A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 02 Nov 2008 17:43

The entry "2qv5A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Nov 2008 17:25

Retrieved SSAP results for job ID SID3745238185244800 and results inserted.

Domain scan ssap cath by auto on 02 Nov 2008 17:22

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 850 results for 2qv5A01

Update comment by auto on 28 Oct 2008 12:25

SSAP job SID3745238185244800 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:05

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:05

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:51

Giving up on SSAP job SID4859877816870720 because submission time of Wed Oct 22 09:16:13 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:51:37 2008).

Update comment by auto on 22 Oct 2008 09:38

SSAP job SID4859877816870720 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:16

The entry "2qv5A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:16

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:12

Giving up on SSAP job SID9051650140464868 because submission time of Thu Oct 16 05:56:48 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:12:41 2008).

Update comment by auto on 16 Oct 2008 06:15

SSAP job SID9051650140464868 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:56

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:56

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:24

Giving up on SSAP job SID1124077590882568 because submission time of Fri Oct 10 02:53:47 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:24:56 2008).

Update comment by auto on 10 Oct 2008 03:33

SSAP job SID1124077590882568 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:53

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:53

The entry "2qv5A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:40

Retrieved PRC results for job ID SID2986244325618598 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:39

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2qv5A01

Update comment by auto on 08 Oct 2008 21:26

PRC job SID2986244325618598 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:12

The entry "2qv5A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:12

The entry "2qv5A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:52

Retrieved HMM(SAM) results for job ID SID8535255751226336 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2qv5A01

Update comment by auto on 04 Oct 2008 12:46

HMM(SAM) job SID8535255751226336 is not yet finished.

Sam cath submit by auto on 04 Oct 2008 12:24

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 12:24

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 09:43

Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID3098606463355568"

Update comment by auto on 03 Oct 2008 03:49

HMM(SAM) job SID3098606463355568 is not yet finished.

Flow stage update by auto on 03 Oct 2008 03:25

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 03:25

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:28

Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID5398459438005248"

Update comment by auto on 02 Oct 2008 21:00

HMM(SAM) job SID5398459438005248 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:39

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:39

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:19

Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID0742717655277152"

Update comment by auto on 02 Oct 2008 15:07

HMM(SAM) job SID0742717655277152 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:47

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:47

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:05

Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID4436559431484240"

Update comment by auto on 02 Oct 2008 03:40

HMM(SAM) job SID4436559431484240 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 03:11

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 03:11

The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 01:54

Retrieved "2qv5A01" CATHEDRAL results for job ID SID9478602081208816 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 01:53

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 2qv5A01

Update comment by auto on 29 Sep 2008 04:13

"2qv5A01" CATHEDRAL job SID9478602081208816 is not yet finished.

Flow stage update by auto on 29 Sep 2008 03:58

The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 29 Sep 2008 03:58

The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:41

Giving up on "2qv5A01" CATHEDRAL job SID3072703390599840 because submission time of Mon Sep 22 18:58:15 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:41:43 2008).

Update comment by auto on 22 Sep 2008 19:10

"2qv5A01" CATHEDRAL job SID3072703390599840 is not yet finished.

Flow stage update by auto on 22 Sep 2008 18:58

The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Sep 2008 18:58

The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:33

Giving up on "2qv5A01" CATHEDRAL job SID3510574764817188 because submission time of Tue Sep 16 14:59:48 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:33:44 2008).

Update comment by auto on 16 Sep 2008 15:12

"2qv5A01" CATHEDRAL job SID3510574764817188 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:59

The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:59

The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:40

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qv5A01.scanlist" for "2qv5A01"

Write scan list by auto on 16 Sep 2008 14:40

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qv5A01.scanlist" for domain "2qv5A01"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:29

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:24

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 20:34

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 20:13

No in_process hits for Domain "2qv5A01" ready to be processed

Flow stage update by auto on 14 Sep 2008 20:13

NW result present for Domain "2qv5A01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qv5A01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qv5A01"

Insertion by cuff on 10 Sep 2008 14:59

nice chopping