Domain assigned by cuff on 10 Mar 2009 17:49
same superfamily
There are 1 matching structural neighberhood comparisons for CATH ID 3.20.20.370.4.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2nlyA00 | 87.10 | 3.20.20.370 | 216 | 18 | 90 | 1.66 | 1.84 |
>pdb|2qv5A01 RPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEILLQIPLEPFGYP GTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAK AISAPQGFADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV
same superfamily
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2qv5A01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qv5A01
Retrieved PRC_PFAMCATH results for job ID SID6890474958257632 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 2qv5A01
PRC_PFAMCATH job SID6890474958257632 is not yet finished.
The entry "2qv5A01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qv5A01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID3745238185244800 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 850 results for 2qv5A01
SSAP job SID3745238185244800 is not yet finished.
The entry "2qv5A01" has been submitted to the SSAP webservice.
The entry "2qv5A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4859877816870720 because submission time of Wed Oct 22 09:16:13 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:51:37 2008).
SSAP job SID4859877816870720 is not yet finished.
The entry "2qv5A01" has been submitted to the SSAP webservice.
The entry "2qv5A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9051650140464868 because submission time of Thu Oct 16 05:56:48 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:12:41 2008).
SSAP job SID9051650140464868 is not yet finished.
The entry "2qv5A01" has been submitted to the SSAP webservice.
The entry "2qv5A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID1124077590882568 because submission time of Fri Oct 10 02:53:47 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:24:56 2008).
SSAP job SID1124077590882568 is not yet finished.
The entry "2qv5A01" has been submitted to the SSAP webservice.
The entry "2qv5A01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID2986244325618598 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2qv5A01
PRC job SID2986244325618598 is not yet finished.
The entry "2qv5A01" has been submitted to the PRC webservice.
The entry "2qv5A01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID8535255751226336 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2qv5A01
HMM(SAM) job SID8535255751226336 is not yet finished.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID3098606463355568"
HMM(SAM) job SID3098606463355568 is not yet finished.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID5398459438005248"
HMM(SAM) job SID5398459438005248 is not yet finished.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID0742717655277152"
HMM(SAM) job SID0742717655277152 is not yet finished.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qv5A01" HMM(SAM) results for job "SID4436559431484240"
HMM(SAM) job SID4436559431484240 is not yet finished.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
The entry "2qv5A01" has been submitted to the HMM (SAM) webservice.
Retrieved "2qv5A01" CATHEDRAL results for job ID SID9478602081208816 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 2qv5A01
"2qv5A01" CATHEDRAL job SID9478602081208816 is not yet finished.
The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.
The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.
Giving up on "2qv5A01" CATHEDRAL job SID3072703390599840 because submission time of Mon Sep 22 18:58:15 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:41:43 2008).
"2qv5A01" CATHEDRAL job SID3072703390599840 is not yet finished.
The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.
The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.
Giving up on "2qv5A01" CATHEDRAL job SID3510574764817188 because submission time of Tue Sep 16 14:59:48 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:33:44 2008).
"2qv5A01" CATHEDRAL job SID3510574764817188 is not yet finished.
The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.
The entry "2qv5A01" has been submitted to the CATHEDRAL webservice.
ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qv5A01.scanlist" for "2qv5A01"
Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qv5A01.scanlist" for domain "2qv5A01"
Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.
Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.
Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.
Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.
Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2qv5A01" ready to be processed
NW result present for Domain "2qv5A01"
All required files are present for Domain "2qv5A01"
Beginning processing for Domain "2qv5A01"
nice chopping