Domain assigned by cuff on 07 Jan 2009 15:42
same superfamily
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qt3A01 | 3 | 55 |
| 2qt3A01 | 357 | 403 |
| 2qt3A02 | 56 | 356 |
There are 10 matching structural neighberhood comparisons for CATH ID 2.30.40.10.13.1.1.1.1 (SIMAX score < 5)
>pdb|2qt3A01 KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGYGIEVGKKADLVVLNSLSPQWAIIDQA KRLCVIKNGRIIVKDEVIVA
same superfamily
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2qt3A01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qt3A01
Retrieved PRC_PFAMCATH results for job ID SID5587043813882720 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 73 results for 2qt3A01
PRC_PFAMCATH job SID5587043813882720 is not yet finished.
The entry "2qt3A01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qt3A01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID4046979081492000 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1301 results for 2qt3A01
SSAP job SID4046979081492000 is not yet finished.
The entry "2qt3A01" has been submitted to the SSAP webservice.
The entry "2qt3A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID8545443096337120 because submission time of Wed Oct 22 09:14:55 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:50:47 2008).
SSAP job SID8545443096337120 is not yet finished.
The entry "2qt3A01" has been submitted to the SSAP webservice.
The entry "2qt3A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5383541123854376 because submission time of Thu Oct 16 05:55:36 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:11:40 2008).
SSAP job SID5383541123854376 is not yet finished.
The entry "2qt3A01" has been submitted to the SSAP webservice.
The entry "2qt3A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7504188180060806 because submission time of Fri Oct 10 02:52:16 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:23:25 2008).
SSAP job SID7504188180060806 is not yet finished.
The entry "2qt3A01" has been submitted to the SSAP webservice.
The entry "2qt3A01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID1814852899165122 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 20 results for 2qt3A01
PRC job SID1814852899165122 is not yet finished.
The entry "2qt3A01" has been submitted to the PRC webservice.
The entry "2qt3A01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID4163813922666016 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2qt3A01
HMM(SAM) job SID4163813922666016 is not yet finished.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID7805993021358256"
HMM(SAM) job SID7805993021358256 is not yet finished.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID6974139123482944"
HMM(SAM) job SID6974139123482944 is not yet finished.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID4602372924331664"
HMM(SAM) job SID4602372924331664 is not yet finished.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID5347436208540256"
HMM(SAM) job SID5347436208540256 is not yet finished.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.
Retrieved "2qt3A01" CATHEDRAL results for job ID SID4593319305495570 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 33 results for 2qt3A01
"2qt3A01" CATHEDRAL job SID4593319305495570 is not yet finished.
The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.
The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.
Giving up on "2qt3A01" CATHEDRAL job SID4952073262330752 because submission time of Mon Sep 22 18:56:56 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:40:45 2008).
"2qt3A01" CATHEDRAL job SID4952073262330752 is not yet finished.
The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.
The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.
Giving up on "2qt3A01" CATHEDRAL job SID2035040105135040 because submission time of Tue Sep 16 14:58:36 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:32:44 2008).
"2qt3A01" CATHEDRAL job SID2035040105135040 is not yet finished.
The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.
The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.
ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qt3A01.scanlist" for "2qt3A01"
Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qt3A01.scanlist" for domain "2qt3A01"
Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.
Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.
Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.
Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.
Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2qt3A01" ready to be processed
NW result present for Domain "2qt3A01"
All required files are present for Domain "2qt3A01"
Beginning processing for Domain "2qt3A01"
nice chopping