CATH Domain: 2qt3A01 XML data for domain: 2qt3A01

Molscript image for 2qt3A01
2qt3A01
PDB coordinates for domain 2qt3A01

PDB 2qt3, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.13
2.30.40.10.13.1
2.30.40.10.13.1.1
2.30.40.10.13.1.1.1
2.30.40.10.13.1.1.1.1

Segment boundaries for domain 2qt3A01

Chopping figure for domain 2qt3A01
DomainStart PDB ResidueStop PDB Residue
2qt3A01 3 55
2qt3A01 357 403
2qt3A02 56 356

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 2.30.40.10.13.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkrA01 89.24 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 24 84 1.26 1.50
2vhlB01 88.02 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine-6-phosphate deacetylaseBacillus subtilisN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 21 87 2.98 3.43
2icsA01 87.81 Pyrimidine metabolismDihydroorotase [EC:3.5.2.3]Metabolic pathwaysEnterococcus faecalisPutative uncharacterized protein 2.30.40.10 100 25 89 3.70 4.16
3feqA01 87.50 2.30.40.10 105 22 88 2.04 2.30
2qs8A01 87.05 2.30.40.10 99 26 91 2.18 2.40
3be7A01 85.58 2.30.40.10 95 20 90 2.49 2.77
2pajA01 84.73 2.30.40.10 119 24 79 2.12 2.66
2oodA01 78.04 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 17 67 2.98 4.42
1ejxC01 76.42 Arginine and proline metabolismKlebsiella aerogenesPurine metabolismUrease alpha subunit [EC:3.5.1.5]Atrazine degradation 2.30.40.10 185 31 49 2.24 4.50
2imrA01 75.29 Uncharacterized protein DR_0824Deinococcus radiodurans 2.30.40.10 69 10 64 2.89 4.52
Displaying entries 1 to 10 (page 1 of 1)


Domain ATOM Sequence

>pdb|2qt3A01
KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGYGIEVGKKADLVVLNSLSPQWAIIDQA
KRLCVIKNGRIIVKDEVIVA    

Domain COMBS Sequence

>pdb|2qt3A01
MSKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGYGIEVGKKADLVVLNSLSPQWAIID
QAKRLCVIKNGRIIVKDEVIVA    

Domain History Events (85)

Domain assigned by cuff on 07 Jan 2009 15:42

same superfamily

Domain assignment manual match h by cuff on 07 Jan 2009 15:41

homology match

Homcheck allotment by cuff on 07 Jan 2009 15:39

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 07 Jan 2009 15:39

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 30 Oct 2008 15:25

Domain "2qt3A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 30 Oct 2008 15:24

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qt3A01

Flow stage update by auto on 30 Oct 2008 15:22

Retrieved PRC_PFAMCATH results for job ID SID5587043813882720 and results inserted.

Domain scan prc pfamcath by auto on 30 Oct 2008 15:21

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 73 results for 2qt3A01

Update comment by auto on 30 Oct 2008 09:35

PRC_PFAMCATH job SID5587043813882720 is not yet finished.

Prc pfamcath submit by auto on 30 Oct 2008 09:34

The entry "2qt3A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 30 Oct 2008 09:34

The entry "2qt3A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 30 Oct 2008 09:19

Retrieved SSAP results for job ID SID4046979081492000 and results inserted.

Domain scan ssap cath by auto on 30 Oct 2008 09:15

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1301 results for 2qt3A01

Update comment by auto on 28 Oct 2008 12:24

SSAP job SID4046979081492000 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:04

The entry "2qt3A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:04

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:50

Giving up on SSAP job SID8545443096337120 because submission time of Wed Oct 22 09:14:55 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:50:47 2008).

Update comment by auto on 22 Oct 2008 09:37

SSAP job SID8545443096337120 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:14

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:14

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:11

Giving up on SSAP job SID5383541123854376 because submission time of Thu Oct 16 05:55:36 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:11:40 2008).

Update comment by auto on 16 Oct 2008 06:13

SSAP job SID5383541123854376 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:55

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:55

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:23

Giving up on SSAP job SID7504188180060806 because submission time of Fri Oct 10 02:52:16 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:23:25 2008).

Update comment by auto on 10 Oct 2008 03:31

SSAP job SID7504188180060806 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:52

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:52

The entry "2qt3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:27

Retrieved PRC results for job ID SID1814852899165122 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:26

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 20 results for 2qt3A01

Update comment by auto on 08 Oct 2008 21:25

PRC job SID1814852899165122 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:10

The entry "2qt3A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:10

The entry "2qt3A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:46

Retrieved HMM(SAM) results for job ID SID4163813922666016 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2qt3A01

Update comment by auto on 04 Oct 2008 09:42

HMM(SAM) job SID4163813922666016 is not yet finished.

Sam cath submit by auto on 04 Oct 2008 09:32

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 09:32

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 06:39

Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID7805993021358256"

Update comment by auto on 03 Oct 2008 03:48

HMM(SAM) job SID7805993021358256 is not yet finished.

Flow stage update by auto on 03 Oct 2008 03:23

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 03:23

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:26

Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID6974139123482944"

Update comment by auto on 02 Oct 2008 20:59

HMM(SAM) job SID6974139123482944 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:38

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:38

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:18

Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID4602372924331664"

Update comment by auto on 02 Oct 2008 15:06

HMM(SAM) job SID4602372924331664 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:45

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:45

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:04

Unable to retrieve "2qt3A01" HMM(SAM) results for job "SID5347436208540256"

Update comment by auto on 02 Oct 2008 03:39

HMM(SAM) job SID5347436208540256 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:09

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:09

The entry "2qt3A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 01:38

Retrieved "2qt3A01" CATHEDRAL results for job ID SID4593319305495570 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 01:37

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 33 results for 2qt3A01

Update comment by auto on 29 Sep 2008 04:12

"2qt3A01" CATHEDRAL job SID4593319305495570 is not yet finished.

Cathedral cath submit by auto on 29 Sep 2008 03:57

The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 29 Sep 2008 03:57

The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:40

Giving up on "2qt3A01" CATHEDRAL job SID4952073262330752 because submission time of Mon Sep 22 18:56:56 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:40:45 2008).

Update comment by auto on 22 Sep 2008 19:09

"2qt3A01" CATHEDRAL job SID4952073262330752 is not yet finished.

Cathedral cath submit by auto on 22 Sep 2008 18:56

The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 18:56

The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:32

Giving up on "2qt3A01" CATHEDRAL job SID2035040105135040 because submission time of Tue Sep 16 14:58:36 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:32:44 2008).

Update comment by auto on 16 Sep 2008 15:11

"2qt3A01" CATHEDRAL job SID2035040105135040 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:58

The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:58

The entry "2qt3A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:38

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qt3A01.scanlist" for "2qt3A01"

Write scan list by auto on 16 Sep 2008 14:37

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qt3A01.scanlist" for domain "2qt3A01"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:28

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:23

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 17:35

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 17:11

No in_process hits for Domain "2qt3A01" ready to be processed

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qt3A01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qt3A01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qt3A01"

Insertion by cuff on 10 Sep 2008 14:59

nice chopping