CATH Domain: 2qswA00 XML data for domain: 2qswA00

Molscript image for 2qswA00
2qswA00
PDB coordinates for domain 2qswA00

PDB 2qsw, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.260 Gene3D
3.30.70.260.3
3.30.70.260.3.1
3.30.70.260.3.1.1
3.30.70.260.3.1.1.1
3.30.70.260.3.1.1.1.1

[top]
Segment boundaries for domain 2qswA00

Chopping figure for domain 2qswA00
DomainStart PDB ResidueStop PDB Residue
2qswA00 256 345

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.30.70.260.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qrrA00 86.20 D-methionine transport system ATP-binding proteinMethionine import ATP-binding protein MetNVibrio parahaemolyticusABC transporters 3.30.70.260 93 29 87 3.18 3.65
3cedA00 84.22 ABC transportersD-methionine transport system ATP-binding proteinMethionine import ATP-binding protein MetN 2Staphylococcus aureus subsp. aureus Mu50 3.30.70.260 97 28 83 2.78 3.33
2qmwA03 79.83 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50 3.30.70.260 73 15 82 3.93 4.74
2nzcA00 79.44 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 9 86 3.77 4.35
1sc6A03 78.87 Glycine, serine and threonine metabolismMetabolic pathwaysD-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]D-3-phosphoglycerate dehydrogenaseEscherichia coli K-12 3.30.70.260 79 7 89 4.10 4.61
2nyiA02 78.07 3.30.70.260 89 10 78 3.49 4.44
1u8sA02 77.49 Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae 3.30.70.260 84 9 80 3.67 4.53
1u0sA00 76.91 Thermotoga maritimaBacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Protein binding 3.30.70.1110 86 8 75 3.62 4.79
2nyiA01 76.84 3.30.70.260 77 5 81 3.92 4.80
1vr6A01 76.83 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysThermotoga maritima3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]Phospho-2-dehydro-3-deoxyheptonate aldolase 3.30.70.1140 75 2 79 3.77 4.76
1y7pB01 75.87 Archaeoglobus fulgidusUncharacterized protein AF_1403 3.30.70.260 80 11 82 4.11 4.96
1rk8A00 75.71 SpliceosomeRNA-binding protein 8AMicrotubule cytoskeleton organizationNucleusDrosophila melanogaster 3.30.70.330 87 14 88 4.39 4.96
1fjeB01 74.90 NucleolinMesocricetus auratus 3.30.70.330 81 9 84 4.18 4.97
1eayD00 74.34 Bacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Escherichia coli K-12Chemotaxis protein cheA 3.30.70.400 69 8 79 3.86 4.87
1f0xA04 72.30 Pyruvate metabolismD-lactate dehydrogenaseNAD or NADH bindingEscherichia coli K-12D-lactate dehydrogenase [EC:1.1.1.28] 3.30.1370.20 85 6 88 4.34 4.92
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qswA00
LVVEELEQYPNGKIVRLLFHGEQAKLPIISHIVQEYQVEVSIIQGNIQQTKQGAVGSLYIQLLGEEQNILAAIEGLRKLR
VETEVIGNE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qswA00
SNAKNIEETELVVEEXLEQYPNGKIVRLLFHGEQAKLPIISHIVQEYQVEVSIIQGNIQQTKQGAVGSLYIQLLGEEQNI
LAAIEGLRKLRVETEVIGNE
BLAST against CATH

[top]
Domain History Events (85)

Domain assigned by cuff on 10 Mar 2009 18:17

same superfamily

Domain assignment manual match h by cuff on 10 Mar 2009 18:14

same superfamily in scop

Homcheck allotment by cuff on 07 Jan 2009 15:28

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 07 Jan 2009 15:28

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 30 Oct 2008 12:17

Domain "2qswA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 30 Oct 2008 12:17

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qswA00

Flow stage update by auto on 30 Oct 2008 12:14

Retrieved PRC_PFAMCATH results for job ID SID6892146358731488 and results inserted.

Domain scan prc pfamcath by auto on 30 Oct 2008 12:13

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2qswA00

Update comment by auto on 30 Oct 2008 06:21

PRC_PFAMCATH job SID6892146358731488 is not yet finished.

Prc pfamcath submit by auto on 30 Oct 2008 06:20

The entry "2qswA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 30 Oct 2008 06:20

The entry "2qswA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 30 Oct 2008 06:05

Retrieved SSAP results for job ID SID7498569752854224 and results inserted.

Domain scan ssap cath by auto on 30 Oct 2008 06:01

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2316 results for 2qswA00

Update comment by auto on 28 Oct 2008 12:24

SSAP job SID7498569752854224 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:04

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:04

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:50

Giving up on SSAP job SID3512889543960640 because submission time of Wed Oct 22 09:14:40 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:50:38 2008).

Update comment by auto on 22 Oct 2008 09:37

SSAP job SID3512889543960640 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:14

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:14

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:11

Giving up on SSAP job SID7970209391252956 because submission time of Thu Oct 16 05:55:24 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:11:29 2008).

Update comment by auto on 16 Oct 2008 06:13

SSAP job SID7970209391252956 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:55

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:55

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:23

Giving up on SSAP job SID9636572399852316 because submission time of Fri Oct 10 02:52:00 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:23:02 2008).

Update comment by auto on 10 Oct 2008 03:31

SSAP job SID9636572399852316 is not yet finished.

Flow stage update by auto on 10 Oct 2008 02:52

The entry "2qswA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 02:52

The entry "2qswA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:25

Retrieved PRC results for job ID SID3484039422477526 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:24

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2qswA00

Update comment by auto on 08 Oct 2008 21:24

PRC job SID3484039422477526 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:10

The entry "2qswA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:10

The entry "2qswA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:45

Retrieved HMM(SAM) results for job ID SID5742403861281280 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2qswA00

Update comment by auto on 04 Oct 2008 09:42

HMM(SAM) job SID5742403861281280 is not yet finished.

Sam cath submit by auto on 04 Oct 2008 09:32

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 09:32

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 06:39

Unable to retrieve "2qswA00" HMM(SAM) results for job "SID6601689838017736"

Update comment by auto on 03 Oct 2008 03:48

HMM(SAM) job SID6601689838017736 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 03:23

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 03:23

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:26

Unable to retrieve "2qswA00" HMM(SAM) results for job "SID1043429906235200"

Update comment by auto on 02 Oct 2008 20:58

HMM(SAM) job SID1043429906235200 is not yet finished.

Flow stage update by auto on 02 Oct 2008 20:38

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 20:38

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:18

Unable to retrieve "2qswA00" HMM(SAM) results for job "SID4082188664784792"

Update comment by auto on 02 Oct 2008 15:06

HMM(SAM) job SID4082188664784792 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:45

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:45

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:04

Unable to retrieve "2qswA00" HMM(SAM) results for job "SID0222815983722144"

Update comment by auto on 02 Oct 2008 03:39

HMM(SAM) job SID0222815983722144 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:09

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:09

The entry "2qswA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 01:37

Retrieved "2qswA00" CATHEDRAL results for job ID SID2904842740055412 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 01:36

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 215 results for 2qswA00

Update comment by auto on 29 Sep 2008 04:12

"2qswA00" CATHEDRAL job SID2904842740055412 is not yet finished.

Cathedral cath submit by auto on 29 Sep 2008 03:57

The entry "2qswA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 29 Sep 2008 03:57

The entry "2qswA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:40

Giving up on "2qswA00" CATHEDRAL job SID2910062819670848 because submission time of Mon Sep 22 18:56:51 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:40:40 2008).

Update comment by auto on 22 Sep 2008 19:09

"2qswA00" CATHEDRAL job SID2910062819670848 is not yet finished.

Cathedral cath submit by auto on 22 Sep 2008 18:56

The entry "2qswA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 18:56

The entry "2qswA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:32

Giving up on "2qswA00" CATHEDRAL job SID0230074829467664 because submission time of Tue Sep 16 14:58:30 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:32:40 2008).

Update comment by auto on 16 Sep 2008 15:11

"2qswA00" CATHEDRAL job SID0230074829467664 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:58

The entry "2qswA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:58

The entry "2qswA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:37

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qswA00.scanlist" for "2qswA00"

Write scan list by auto on 16 Sep 2008 14:37

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qswA00.scanlist" for domain "2qswA00"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:28

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:23

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 17:35

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 17:11

No in_process hits for Domain "2qswA00" ready to be processed

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qswA00"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qswA00"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qswA00"

Insertion by cuff on 10 Sep 2008 14:59

nice chopping