CATH Domain: 2qsaA00

2qsaA00

PDB 2qsa, Chain A, Domain 0

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.287	Helix Hairpins
1.10.287.110		Gene3D
1.10.287.110.3
1.10.287.110.3.1
1.10.287.110.3.1.1
1.10.287.110.3.1.1.1
1.10.287.110.3.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qsaA00

Domain	Start PDB Residue	Stop PDB Residue
2qsaA00	22	122

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.287.110.3.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2ochA00	83.13	Caenorhabditis elegansProtein F39B2.10, confirmed by transcript evidenceDnaJ homolog subfamily A member 1Embryo development ending in birth or egg hatchingMitotic spindle organization	1.10.287.110	61	34	65	2.34	3.59

[top]
Domain ATOM Sequence

>pdb|2qsaA00
NAVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNY
DYYLDHPDQRFYNYYQYYRLR

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qsaA00
SNAVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTN
YDYYLDHPDQRFYNYYQYYRLRAAPKVDL

BLAST against CATH

[top]
Domain History Events (76)

Domain assigned by cuff on 07 Jan 2009 14:42

same superfamily

Domain assignment manual match h by cuff on 07 Jan 2009 14:41

homology match

Homcheck allotment by cuff on 07 Jan 2009 14:39

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 07 Jan 2009 14:39

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 29 Oct 2008 18:11

Domain "2qsaA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 29 Oct 2008 18:11

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qsaA00

Flow stage update by auto on 29 Oct 2008 18:03

Retrieved PRC_PFAMCATH results for job ID SID7510807309224408 and results inserted.

Domain scan prc pfamcath by auto on 29 Oct 2008 18:02

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 9 results for 2qsaA00

Update comment by auto on 29 Oct 2008 08:58

PRC_PFAMCATH job SID7510807309224408 is not yet finished.

Prc pfamcath submit by auto on 29 Oct 2008 08:57

The entry "2qsaA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 29 Oct 2008 08:57

The entry "2qsaA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 29 Oct 2008 08:42

Retrieved SSAP results for job ID SID4777984916299950 and results inserted.

Domain scan ssap cath by auto on 29 Oct 2008 08:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2033 results for 2qsaA00

Update comment by auto on 28 Oct 2008 12:23

SSAP job SID4777984916299950 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:03

The entry "2qsaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:03

The entry "2qsaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:49

Giving up on SSAP job SID8611395057647168 because submission time of Wed Oct 22 09:13:29 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:49:55 2008).

Update comment by auto on 22 Oct 2008 09:36

SSAP job SID8611395057647168 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:13

The entry "2qsaA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:13

The entry "2qsaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:10

Giving up on SSAP job SID3840729019268808 because submission time of Thu Oct 16 05:54:21 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:10:35 2008).

Update comment by auto on 16 Oct 2008 06:12

SSAP job SID3840729019268808 is not yet finished.

Flow stage update by auto on 16 Oct 2008 05:54

The entry "2qsaA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 05:54

The entry "2qsaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:21

Giving up on SSAP job SID9217284458683716 because submission time of Fri Oct 10 02:50:35 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:21:42 2008).

Update comment by auto on 10 Oct 2008 03:30

SSAP job SID9217284458683716 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:50

The entry "2qsaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:50

The entry "2qsaA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:17

Retrieved PRC results for job ID SID8001299201873894 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:16

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2qsaA00

Update comment by auto on 08 Oct 2008 21:24

PRC job SID8001299201873894 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:09

The entry "2qsaA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:09

The entry "2qsaA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:42

Retrieved HMM(SAM) results for job ID SID9776462257328352 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:41

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 2qsaA00