CATH Domain: 2qs8A01 XML data for domain: 2qs8A01

Molscript image for 2qs8A01
2qs8A01
PDB coordinates for domain 2qs8A01

PDB 2qs8, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.18
2.30.40.10.18.1
2.30.40.10.18.1.1
2.30.40.10.18.1.1.1
2.30.40.10.18.1.1.1.1

[top]
Segment boundaries for domain 2qs8A01

Chopping figure for domain 2qs8A01
DomainStart PDB ResidueStop PDB Residue
2qs8A01 7 65
2qs8A01 373 412
2qs8A02 67 372

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.30.40.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3feqA01 89.31 2.30.40.10 105 32 93 2.15 2.30
1gkrA01 85.48 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 14 80 1.97 2.44
1o12A01 83.52 Amino sugar and nucleotide sugar metabolismThermotoga maritimaN-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 72 19 71 2.78 3.88
2oodA01 79.05 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 15 68 2.87 4.17
2imrA01 78.27 Uncharacterized protein DR_0824Deinococcus radiodurans 2.30.40.10 69 10 66 3.25 4.88
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qs8A01
SKTLIHAGKLIDGKSDQVQSRISIVIDGNIISDIKKGFISSNDFEDYIDLRDHTVLPGLGSIESGKLADLIAVKGNPIED
ISVLENVDVVIKDGLLYEG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qs8A01
XSLDVDSKTLIHAGKLIDGKSDQVQSRISIVIDGNIISDIKKGFISSNDFEDYIDLRDHTVLPGLGSIESGKLADLIAVK
GNPIEDISVLENVDVVIKDGLLYEGHHHHHH
BLAST against CATH

[top]
Domain History Events (85)

Domain assigned by cuff on 07 Jan 2009 14:32

same superfamily

Domain assignment manual match h by cuff on 07 Jan 2009 14:28

homology match

Homcheck allotment by cuff on 07 Jan 2009 14:23

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 07 Jan 2009 14:23

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 29 Oct 2008 20:53

Domain "2qs8A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 29 Oct 2008 20:53

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qs8A01

Flow stage update by auto on 29 Oct 2008 20:47

Retrieved PRC_PFAMCATH results for job ID SID0780875330188160 and results inserted.

Domain scan prc pfamcath by auto on 29 Oct 2008 20:47

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 40 results for 2qs8A01

Update comment by auto on 29 Oct 2008 14:52

PRC_PFAMCATH job SID0780875330188160 is not yet finished.

Flow stage update by auto on 29 Oct 2008 14:51

The entry "2qs8A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 29 Oct 2008 14:51

The entry "2qs8A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 29 Oct 2008 14:31

Retrieved SSAP results for job ID SID0504778297334428 and results inserted.

Domain scan ssap cath by auto on 29 Oct 2008 14:27

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1839 results for 2qs8A01

Update comment by auto on 28 Oct 2008 12:23

SSAP job SID0504778297334428 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:03

The entry "2qs8A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:03

The entry "2qs8A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:49

Giving up on SSAP job SID1075553368877966 because submission time of Wed Oct 22 09:13:40 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:49:59 2008).

Update comment by auto on 22 Oct 2008 09:36

SSAP job SID1075553368877966 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:13

The entry "2qs8A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:13

The entry "2qs8A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:10

Giving up on SSAP job SID5002296205426760 because submission time of Thu Oct 16 05:54:29 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:10:40 2008).

Update comment by auto on 16 Oct 2008 06:12

SSAP job SID5002296205426760 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:54

The entry "2qs8A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:54

The entry "2qs8A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:21

Giving up on SSAP job SID4559356250202316 because submission time of Fri Oct 10 02:50:43 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:21:49 2008).

Update comment by auto on 10 Oct 2008 03:30

SSAP job SID4559356250202316 is not yet finished.

Flow stage update by auto on 10 Oct 2008 02:50

The entry "2qs8A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 02:50

The entry "2qs8A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:15

Retrieved PRC results for job ID SID7219374733070078 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:14

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 17 results for 2qs8A01

Update comment by auto on 08 Oct 2008 21:23

PRC job SID7219374733070078 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 21:09

The entry "2qs8A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 21:09

The entry "2qs8A01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:41

Retrieved HMM(SAM) results for job ID SID6500421850552544 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:40

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2qs8A01

Update comment by auto on 04 Oct 2008 09:41

HMM(SAM) job SID6500421850552544 is not yet finished.

Sam cath submit by auto on 04 Oct 2008 09:31

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 09:31

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Oct 2008 06:37

Unable to retrieve "2qs8A01" HMM(SAM) results for job "SID0284448271447856"

Update comment by auto on 03 Oct 2008 03:47

HMM(SAM) job SID0284448271447856 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 03:22

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 03:22

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:25

Unable to retrieve "2qs8A01" HMM(SAM) results for job "SID1923621341502656"

Update comment by auto on 02 Oct 2008 20:58

HMM(SAM) job SID1923621341502656 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:37

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:37

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:17

Unable to retrieve "2qs8A01" HMM(SAM) results for job "SID8588805740268696"

Update comment by auto on 02 Oct 2008 15:05

HMM(SAM) job SID8588805740268696 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:44

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:44

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:03

Unable to retrieve "2qs8A01" HMM(SAM) results for job "SID0473228514489856"

Update comment by auto on 02 Oct 2008 03:37

HMM(SAM) job SID0473228514489856 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 03:08

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 03:08

The entry "2qs8A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 01:26

Retrieved "2qs8A01" CATHEDRAL results for job ID SID1438968691487363 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 01:26

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 28 results for 2qs8A01

Update comment by auto on 29 Sep 2008 04:11

"2qs8A01" CATHEDRAL job SID1438968691487363 is not yet finished.

Cathedral cath submit by auto on 29 Sep 2008 03:56

The entry "2qs8A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 29 Sep 2008 03:56

The entry "2qs8A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:39

Giving up on "2qs8A01" CATHEDRAL job SID8744484498790816 because submission time of Mon Sep 22 18:55:57 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:39:59 2008).

Update comment by auto on 22 Sep 2008 19:09

"2qs8A01" CATHEDRAL job SID8744484498790816 is not yet finished.

Cathedral cath submit by auto on 22 Sep 2008 18:55

The entry "2qs8A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 18:55

The entry "2qs8A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:32

Giving up on "2qs8A01" CATHEDRAL job SID6133058868522080 because submission time of Tue Sep 16 14:57:37 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:32:01 2008).

Update comment by auto on 16 Sep 2008 15:10

"2qs8A01" CATHEDRAL job SID6133058868522080 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:57

The entry "2qs8A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:57

The entry "2qs8A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:36

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qs8A01.scanlist" for "2qs8A01"

Write scan list by auto on 16 Sep 2008 14:36

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qs8A01.scanlist" for domain "2qs8A01"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:28

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:23

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 17:35

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 17:11

No in_process hits for Domain "2qs8A01" ready to be processed

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qs8A01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qs8A01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qs8A01"

Insertion by cuff on 10 Sep 2008 12:56

nice chopping