CATH Domain: 2qr3A00

2qr3A00

PDB 2qr3, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.50	Rossmann fold
3.40.50.2300		Gene3D
3.40.50.2300.47
3.40.50.2300.47.1
3.40.50.2300.47.1.1
3.40.50.2300.47.1.1.1
3.40.50.2300.47.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qr3A00

Domain	Start PDB Residue	Stop PDB Residue
2qr3A00	0	125

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (55 entries)

There are 55 matching structural neighberhood comparisons for CATH ID 3.40.50.2300.47.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2qzjA00	88.74	Two-component response regulatorClostridium difficile 630	3.40.50.2300	119	14	97	2.13	2.19
2qxyA00	88.69	Thermotoga maritimaResponse regulatorTwo-component system, unclassified family, response regulator	3.40.50.2300	118	28	97	1.93	1.98
1zgzA00	88.48	Two-component systemTorCAD operon transcriptional regulatory protein torRTwo-component system, OmpR family, torCAD operon response regulator TorRProtein bindingEscherichia coli K-12	3.40.50.2300	118	21	96	2.00	2.07
3gl9B00	88.41	Thermotoga maritimaResponse regulatorTwo-component system, unclassified family, response regulatorProtein binding	3.40.50.2300	118	19	95	2.03	2.12
1srrC00	88.24	Sporulation initiation phosphotransferase FTwo-component system, response regulator, stage 0 sporulation protein FBacillus subtilisTwo-component system	3.40.50.2300	121	21	98	2.48	2.52
1p2fA01	88.00	Thermotoga maritimaResponse regulatorTwo-component system, OmpR family, response regulator	3.40.50.2300	117	26	94	2.25	2.39
3cnbA00	87.79	DNA-binding response regulator, merR familyColwellia psychrerythraea 34H	3.40.50.2300	124	24	94	2.03	2.15
1ny5A01	87.55	Transcriptional regulator (NtrC family)Two-component system, NtrC family, response regulatorAquifex aeolicus	3.40.50.2300	136	26	86	1.84	2.14
2qsjB00	87.35	DNA-binding response regulator, LuxR familyRuegeria pomeroyi	3.40.50.2300	122	21	90	1.96	2.17
2zayA00	87.03	Response regulator receiver proteinDesulfuromonas acetoxidans DSM 684	3.40.50.2300	123	17	95	1.99	2.07
1a04A01	86.34	Two-component systemTwo-component system, NarL family, nitrate/nitrite response regulator NarLProtein bindingEscherichia coli K-12Nitrate/nitrite response regulator protein narL	3.40.50.2300	124	24	95	2.33	2.43
3b2nA00	86.30	Similar to two-component response regulatorStaphylococcus aureus subsp. aureus Mu50	3.40.50.2300	119	21	96	2.25	2.33
3eq2B01	85.92	Pseudomonas aeruginosaProbable two-component response regulator	3.40.50.2300	103	22	85	1.81	2.11
1a2oA01	85.81	Bacterial chemotaxisTwo-component systemChemotaxis response regulator protein-glutamate methylesteraseTwo-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]Salmonella enterica subsp. enterica serovar Typhimurium	3.40.50.2300	133	25	87	1.89	2.15
3gt7A00	85.69	Sensor proteinSyntrophus aciditrophicus SB	3.40.50.2300	131	23	90	2.46	2.73
1w25B02	85.57	Two-component systemCell cycle - CaulobacterCaulobacter vibrioidesIdentical protein bindingTwo-component system, cell cycle response regulator	3.40.50.2300	143	21	82	1.69	2.05
2qv0A00	85.52	Protein mrkEKlebsiella pneumoniae	3.40.50.2300	122	21	94	2.44	2.59
2b4aA00	85.51	BH3024 proteinBacillus halodurans	3.40.50.2300	116	13	95	2.67	2.79
3cu5B00	85.26	Clostridium phytofermentans ISDgTwo component transcriptional regulator, AraC family	3.40.50.2300	129	22	91	2.28	2.49
3cz5B00	84.59	Two-component response regulator, LuxR familyAurantimonas manganoxydans SI85-9A1	3.40.50.2300	140	21	85	2.10	2.47
1dcfA00	83.85	Response to insectResponse to abscisic acid stimulusResponse to heatResponse to gibberellin stimulusDefense response to bacterium	3.40.50.2300	133	17	89	2.85	3.19
1qo0D01	81.10	Pseudomonas aeruginosaAliphatic amidase regulator	3.40.50.2300	127	12	90	2.90	3.20
2ayzA00	81.03	Two-component systemTwo-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]Sensor kinase protein rcsCEscherichia coli K-12	3.40.50.2300	133	21	87	2.83	3.22
1jr2A01	80.02	Uroporphyrinogen-III synthase [EC:4.2.1.75]Metabolic pathwaysPorphyrin and chlorophyll metabolismUroporphyrinogen-III synthase activityHomo sapiens	3.40.50.10090	120	10	90	3.28	3.61
1p6qA00	79.95	CheY2Two-component system, chemotaxis family, response regulator CheYBacterial chemotaxisSinorhizobium melilotiTwo-component system	3.40.50.2300	129	17	92	3.23	3.50
3d8uB01	79.47	Putative transcriptional regulatorVibrio parahaemolyticusLacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor	3.40.50.2300	119	16	83	3.06	3.68
1wcwA01	79.30	Thermus thermophilus HB8Uroporphyrinogen-III synthase [EC:4.2.1.75]Probable uroporphyrinogen-III synthasePorphyrin and chlorophyll metabolismMetabolic pathways	3.40.50.10090	125	8	88	3.43	3.90
2q5cA01	78.78	Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains)	3.40.50.2300	97	11	74	2.77	3.70
3cwcB01	78.72	Glycerate kinase [EC:2.7.1.31]Glycerolipid metabolismSalmonella enterica subsp. enterica serovar TyphimuriumPutative glycerate kinase 2Glycine, serine and threonine metabolism	3.40.50.10350	137	15	75	3.73	4.91
1y7pB02	78.64	Archaeoglobus fulgidusUncharacterized protein AF_1403	3.40.50.10550	137	10	78	3.79	4.85
2qu7A01	78.32	Putative transcriptional regulatorStaphylococcus saprophyticus subsp. saprophyticus ATCC 15305	3.40.50.2300	129	10	79	2.88	3.61
2pjuC01	77.70	Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity	3.40.50.2300	100	11	73	2.38	3.22
1bykA02	77.66	Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR	3.40.50.2300	117	9	74	2.65	3.54
3clkB01	77.57	Lactobacillus plantarumTranscription regulator	3.40.50.2300	119	11	83	3.44	4.13
2fepA01	77.49	Bacillus subtilisCatabolite control protein ALacI family transcriptional regulator	3.40.50.2300	133	13	78	3.26	4.17
3cs3A01	77.36	Sugar-binding transcriptional regulator, LacI familyLacI family transcriptional regulatorEnterococcus faecalis	3.40.50.2300	122	7	86	3.39	3.94
1eiwA00	77.32	Methanothermobacter thermautotrophicus str. Delta HProtein MTH_538	3.40.50.9200	111	9	86	3.51	4.06
2o2cA02	77.27	Glucose-6-phosphate isomerase, glycosomalTrypanosoma brucei brucei	3.40.50.10490	134	6	72	3.53	4.88
1dbqA01	77.02	LacI family transcriptional regulator, purine nucleotide synthesis repressorHTH-type transcriptional repressor purREscherichia coli K-12	3.40.50.2300	134	12	77	3.00	3.87
2rgyA01	76.95	LacI family transcriptional regulatorBurkholderia phymatum STM815Transcriptional regulator, LacI family	3.40.50.2300	122	12	83	3.19	3.82
1z0sA01	76.86	Archaeoglobus fulgidusProbable inorganic polyphosphate/ATP-NAD kinaseNAD+ kinase [EC:2.7.1.23]Nicotinate and nicotinamide metabolismMetabolic pathways	3.40.50.10330	123	10	78	3.09	3.92
2iksA01	76.76	LacI family transcriptional regulator, fructose operon transcriptional repressorFructose repressorEscherichia coli K-12	3.40.50.2300	95	6	67	3.21	4.77
3bblA01	76.72	Chloroflexus aggregans DSM 9485LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupGTranscriptional regulator, LacI family	3.40.50.2300	136	10	75	3.53	4.66
2hqbA01	76.71	Transcriptional activator of comK geneTranscriptional activator of comK geneBacillus halodurans	3.40.50.2300	130	7	79	3.10	3.91
2kyrA00	76.70	PTS system, fructose-specific IIB-like component [EC:2.7.1.69]Escherichia coli K-12Fructose-like phosphotransferase enzyme IIB component 1	3.40.50.2300	108	7	77	3.42	4.42
3brqB01	76.59	Negative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activityHTH-type transcriptional regulator ascGSequence-specific DNA binding transcription factor activity	3.40.50.2300	127	9	79	3.18	4.00
1t1jA00	76.34	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.50.10400	119	5	71	3.42	4.79
2js7A01	76.16	Myeloid differentiation primary response protein MyD88Response to interleukin-1Death receptor bindingHomo sapiensCell surface receptor linked signaling pathway	3.40.50.10140	136	6	81	3.98	4.88
1gtzA00	75.98	Phenylalanine, tyrosine and tryptophan biosynthesis3-dehydroquinate dehydratase II [EC:4.2.1.10]Streptomyces coelicolor3-dehydroquinate dehydrataseMetabolic pathways	3.40.50.9100	149	14	76	3.52	4.60
1kjnA00	75.80	Methanothermobacter thermautotrophicus str. Delta HConserved protein	3.40.50.10160	148	8	71	2.87	4.01
1u0tB01	75.17	Nicotinate and nicotinamide metabolismMetabolic pathwaysNAD+ kinase [EC:2.7.1.23]Inorganic polyphosphate/ATP-NAD kinaseMycobacterium tuberculosis	3.40.50.10330	138	14	70	3.11	4.42
2pjuA02	74.25	Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity	3.40.50.10660	88	7	57	2.59	4.53
1cvrA01	74.10	Gingipain R [EC:3.4.22.37]Porphyromonas gingivalisGingipain R2	3.40.50.10390	117	5	69	3.34	4.79
3bilA02	73.45	Corynebacterium glutamicumPROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR	3.40.50.2300	136	5	73	3.66	4.98
2qu7A02	71.86	Putative transcriptional regulatorStaphylococcus saprophyticus subsp. saprophyticus ATCC 15305	3.40.50.2300	137	10	69	3.42	4.93

[top]
Domain ATOM Sequence

>pdb|2qr3A00
SLGTIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTSNEGLFWLHEIKRQYRDLPVVLF
TAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qr3A00
MSLGTIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTSGINNGNEGLFWLHEIKRQYRD
LPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQAKDGKKEGHHHHHH

BLAST against CATH

[top]
Domain History Events (85)

Domain assigned by cuff on 07 Jan 2009 14:08

same superfamily

Domain assignment manual match h by cuff on 07 Jan 2009 14:07

homology match

Homcheck allotment by cuff on 07 Jan 2009 14:06

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 07 Jan 2009 14:06

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 29 Oct 2008 20:52

Domain "2qr3A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 29 Oct 2008 20:52

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qr3A00

Flow stage update by auto on 29 Oct 2008 20:46

Retrieved PRC_PFAMCATH results for job ID SID5438529334927430 and results inserted.

Domain scan prc pfamcath by auto on 29 Oct 2008 20:45

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 93 results for 2qr3A00

Update comment by auto on 29 Oct 2008 18:01

PRC_PFAMCATH job SID5438529334927430 is not yet finished.

Flow stage update by auto on 29 Oct 2008 18:00

The entry "2qr3A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 29 Oct 2008 18:00

The entry "2qr3A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 29 Oct 2008 17:38

Retrieved SSAP results for job ID SID2160537223916736 and results inserted.

Domain scan ssap cath by auto on 29 Oct 2008 17:32

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3153 results for 2qr3A00

Update comment by auto on 28 Oct 2008 12:22

SSAP job SID2160537223916736 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:02

The entry "2qr3A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:02

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:49

Giving up on SSAP job SID4538130816935136 because submission time of Wed Oct 22 09:12:51 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:49:29 2008).

Update comment by auto on 22 Oct 2008 09:36

SSAP job SID4538130816935136 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:12

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:12

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:09

Giving up on SSAP job SID5516222812602602 because submission time of Thu Oct 16 05:53:42 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:09:59 2008).

Update comment by auto on 16 Oct 2008 06:12

SSAP job SID5516222812602602 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 05:53

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 05:53

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:20

Giving up on SSAP job SID0038653347487522 because submission time of Fri Oct 10 02:49:43 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:20:52 2008).

Update comment by auto on 10 Oct 2008 03:29

SSAP job SID0038653347487522 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:49

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:49

The entry "2qr3A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:11

Retrieved PRC results for job ID SID1461096991859979 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:10

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 26 results for 2qr3A00

Update comment by auto on 08 Oct 2008 21:23

PRC job SID1461096991859979 is not yet finished.

Flow stage update by auto on 08 Oct 2008 21:08

The entry "2qr3A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 21:08

The entry "2qr3A00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 20:38

Retrieved HMM(SAM) results for job ID SID7416180823176480 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 20:37

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 26 results for 2qr3A00