Domain assigned by cuff on 06 Jan 2009 17:18
same superfamily
CATH Domain: 2qq6B01
2qq6B01
PDB 2qq6, Chain B, Domain 1
Segment boundaries for domain 2qq6B01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qq6B01 | 7 | 105 |
| 2qq6B01 | 373 | 391 |
| 2qq6B02 | 106 | 372 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.390.10.32.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1jpdX01 | 83.24 | 3.30.390.10 | 99 | 21 | 71 | 2.20 | 3.09 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2qq6B01 TRVETAAIRAVGPSVLVRVWAGDEHGLGECYPSAPAAGIHHIVNEEQLLGEDPRDVERLYEKRRWNIFTGGQAGAVITAL SGIETALWDLAGKLQGPGLGLELDEEAAFEHRHEK
Domain History Events (81)
Domain assignment manual match h by cuff on 06 Jan 2009 17:15
homology match
Homcheck allotment by cuff on 06 Jan 2009 17:14
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 06 Jan 2009 17:14
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 23 Oct 2008 12:48
Domain "2qq6B01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 23 Oct 2008 12:47
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qq6B01
Flow stage update by auto on 23 Oct 2008 12:46
Retrieved PRC_PFAMCATH results for job ID SID3970718105060704 and results inserted.
Domain scan prc pfamcath by auto on 23 Oct 2008 12:45
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 33 results for 2qq6B01
Update comment by auto on 23 Oct 2008 00:22
PRC_PFAMCATH job SID3970718105060704 is not yet finished.
Flow stage update by auto on 23 Oct 2008 00:22
The entry "2qq6B01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 23 Oct 2008 00:22
The entry "2qq6B01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 23 Oct 2008 00:03
Retrieved SSAP results for job ID SID6053909310620544 and results inserted.
Domain scan ssap cath by auto on 22 Oct 2008 23:53
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2715 results for 2qq6B01
Update comment by auto on 22 Oct 2008 09:35
SSAP job SID6053909310620544 is not yet finished.
Ssap cath submit by auto on 22 Oct 2008 09:12
The entry "2qq6B01" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 09:12
The entry "2qq6B01" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:09
Giving up on SSAP job SID3100255745486520 because submission time of Thu Oct 16 05:53:35 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:09:54 2008).
Update comment by auto on 16 Oct 2008 06:12
SSAP job SID3100255745486520 is not yet finished.
Flow stage update by auto on 16 Oct 2008 05:53
The entry "2qq6B01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 16 Oct 2008 05:53
The entry "2qq6B01" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:20
Giving up on SSAP job SID6723926988528704 because submission time of Fri Oct 10 02:49:33 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:20:45 2008).
Update comment by auto on 10 Oct 2008 03:29
SSAP job SID6723926988528704 is not yet finished.
Flow stage update by auto on 10 Oct 2008 02:49
The entry "2qq6B01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 10 Oct 2008 02:49
The entry "2qq6B01" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 00:09
Retrieved PRC results for job ID SID8924877483172164 and inserted them into the database.
Domain scan prc cath by auto on 10 Oct 2008 00:08
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 42 results for 2qq6B01
Update comment by auto on 08 Oct 2008 15:23
PRC job SID8924877483172164 is not yet finished.
Prc cath submit by auto on 08 Oct 2008 15:14
The entry "2qq6B01" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 15:14
The entry "2qq6B01" has been submitted to the PRC webservice.
Flow stage update by auto on 08 Oct 2008 14:52
Retrieved HMM(SAM) results for job ID SID6525286428418240 and inserted them into the database.
Domain scan sam cath by auto on 08 Oct 2008 14:51
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 26 results for 2qq6B01
Update comment by auto on 03 Oct 2008 20:55
HMM(SAM) job SID6525286428418240 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 20:42
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 20:42
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 17:54
Unable to retrieve "2qq6B01" HMM(SAM) results for job "SID5907057066450016"
Update comment by auto on 03 Oct 2008 00:24
HMM(SAM) job SID5907057066450016 is not yet finished.
Flow stage update by auto on 03 Oct 2008 00:07
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 03 Oct 2008 00:07
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 20:57
Unable to retrieve "2qq6B01" HMM(SAM) results for job "SID8557363209819680"
Update comment by auto on 02 Oct 2008 18:16
HMM(SAM) job SID8557363209819680 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 18:05
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 18:05
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 15:05
Unable to retrieve "2qq6B01" HMM(SAM) results for job "SID0166426837097760"
Update comment by auto on 02 Oct 2008 12:02
HMM(SAM) job SID0166426837097760 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 11:52
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 11:52
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 09:23
Unable to retrieve "2qq6B01" HMM(SAM) results for job "SID3095428854761216"
Update comment by auto on 02 Oct 2008 03:36
HMM(SAM) job SID3095428854761216 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 03:07
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 03:07
The entry "2qq6B01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 01:14
Retrieved "2qq6B01" CATHEDRAL results for job ID SID0365701943884892 and inserted them into the database.
Domain scan cathedral cath by auto on 02 Oct 2008 01:13
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 55 results for 2qq6B01
Update comment by auto on 29 Sep 2008 04:10
"2qq6B01" CATHEDRAL job SID0365701943884892 is not yet finished.
Flow stage update by auto on 29 Sep 2008 03:55
The entry "2qq6B01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 29 Sep 2008 03:55
The entry "2qq6B01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 28 Sep 2008 20:39
Giving up on "2qq6B01" CATHEDRAL job SID9279193598778304 because submission time of Mon Sep 22 18:55:11 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:39:25 2008).
Update comment by auto on 22 Sep 2008 19:08
"2qq6B01" CATHEDRAL job SID9279193598778304 is not yet finished.
Cathedral cath submit by auto on 22 Sep 2008 18:55
The entry "2qq6B01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Sep 2008 18:55
The entry "2qq6B01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Sep 2008 15:31
Giving up on "2qq6B01" CATHEDRAL job SID7631016201321888 because submission time of Tue Sep 16 14:56:46 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:31:26 2008).
Update comment by auto on 16 Sep 2008 15:10
"2qq6B01" CATHEDRAL job SID7631016201321888 is not yet finished.
Flow stage update by auto on 16 Sep 2008 14:56
The entry "2qq6B01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 16 Sep 2008 14:56
The entry "2qq6B01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 16 Sep 2008 14:35
ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qq6B01.scanlist" for "2qq6B01"
Write scan list by auto on 16 Sep 2008 14:34
Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qq6B01.scanlist" for domain "2qq6B01"
Update comment by auto on 16 Sep 2008 11:22
Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 22:07
Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 17:28
Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 15:20
Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 11:23
Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 09:59
Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 03:26
Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 23:23
Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 21:06
Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 17:36
Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Flow stage update by auto on 14 Sep 2008 17:35
No satisfactory AssignClose result found.
Flow stage update by auto on 14 Sep 2008 17:11
No in_process hits for Domain "2qq6B01" ready to be processed
Flow stage update by auto on 14 Sep 2008 17:11
NW result present for Domain "2qq6B01"
Flow stage update by auto on 11 Sep 2008 11:06
All required files are present for Domain "2qq6B01"
Flow stage update by auto on 10 Sep 2008 17:44
Beginning processing for Domain "2qq6B01"
Insertion by auto on 10 Sep 2008 14:06
Final ChopClose added based on similarity with "2qq6A"
