Domain assigned by cuff on 18 Mar 2009 13:40
same superfamily
CATH Domain: 2qpxA00
2qpxA00
PDB 2qpx, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.20
| Alpha-Beta Barrel | |
 3.20.20
| TIM Barrel | |
 3.20.20.140
| Metal-dependent hydrolases | Gene3D |
 3.20.20.140.7
| ||
 3.20.20.140.7.1
| ||
 3.20.20.140.7.1.1
| ||
 3.20.20.140.7.1.1.1
| ||
 3.20.20.140.7.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2qpxA00 GDDLSEFVDQVPLLDHHCHFLIDGKVPNRDDRLAQVSTEADKDYPLADTKNRLAYHGFLALAKEFALDANNPLAANDPGY ATYNHRIFGHFHFKELLIDTGFVPDDPILDLDQTAELVGIPVKAIYRLETHAEDFLEHDNFAAWWQAFSNDVKQAKAHGF VGFSIAAYRVGLHLEPVNVIEAAAGFDTWKHSGEKRLTSKPLIDYLYHVAPFIIAQDPLQFHVGYGDADTDYLGNPLLRD YLKAFTKKGLKVVLLHCYPYHREAGYLASVFPNLYFDISLLDNLGPSGASRVFNEAVELAPYTRILFASDASTYPEYGLA ARQFKQALVAHFNQLPFVDLAQKKAWINAICWQTSAKLYHQERELRV
Domain COMBS Sequence
>pdb|2qpxA00 GXDDLSEFVDQVPLLDHHCHFLIDGKVPNRDDRLAQVSTEADKDYPLADTKNRLAYHGFLALAKEFALDANNPLAAXNDP GYATYNHRIFGHFHFKELLIDTGFVPDDPILDLDQTAELVGIPVKAIYRLETHAEDFXLEHDNFAAWWQAFSNDVKQAKA HGFVGFXSIAAYRVGLHLEPVNVIEAAAGFDTWKHSGEKRLTSKPLIDYXLYHVAPFIIAQDXPLQFHVGYGDADTDXYL GNPLLXRDYLKAFTKKGLKVVLLHCYPYHREAGYLASVFPNLYFDISLLDNLGPSGASRVFNEAVELAPYTRILFASDAS TYPEXYGLAARQFKQALVAHFNQLPFVDLAQKKAWINAICWQTSAKLYHQERELRV
Domain History Events (83)
Domain assignment manual match h by cuff on 18 Mar 2009 13:39
homology match
Homcheck allotment by cuff on 18 Mar 2009 13:36
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 18 Mar 2009 13:36
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 16 Mar 2009 21:37
Domain "2qpxA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 16 Mar 2009 21:36
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qpxA00
Flow stage update by auto on 16 Mar 2009 21:36
Retrieved PRC_PFAMCATH results for job ID SID0436089633796576 and results inserted.
Domain scan prc pfamcath by auto on 16 Mar 2009 21:36
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 33 results for 2qpxA00
Update comment by auto on 16 Mar 2009 18:30
PRC_PFAMCATH job SID0436089633796576 is not yet finished.
Flow stage update by auto on 16 Mar 2009 18:29
The entry "2qpxA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 16 Mar 2009 18:29
The entry "2qpxA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 16 Mar 2009 18:12
Retrieved SSAP results for job ID SID9078426606644800 and results inserted.
Domain scan ssap cath by auto on 16 Mar 2009 18:11
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 138 results for 2qpxA00
Update comment by auto on 10 Mar 2009 02:30
SSAP job SID9078426606644800 is not yet finished.
Flow stage update by auto on 10 Mar 2009 02:16
The entry "2qpxA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 10 Mar 2009 02:16
The entry "2qpxA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Mar 2009 01:13
Retrieved PRC results for job ID SID6304113639892864 and inserted them into the database.
Domain scan prc cath by auto on 10 Mar 2009 01:12
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 11 results for 2qpxA00
Update comment by auto on 09 Mar 2009 19:55
PRC job SID6304113639892864 is not yet finished.
Prc cath submit by auto on 09 Mar 2009 19:37
The entry "2qpxA00" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 19:37
The entry "2qpxA00" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 18:38
Retrieved HMM(SAM) results for job ID SID5100661089713120 and inserted them into the database.
Domain scan sam cath by auto on 09 Mar 2009 18:37
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2qpxA00
Update comment by auto on 04 Mar 2009 16:07
HMM(SAM) job SID5100661089713120 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 15:55
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 15:55
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 12:34
Unable to retrieve "2qpxA00" HMM(SAM) results for job "SID6063614584776672"
Update comment by auto on 04 Mar 2009 04:10
HMM(SAM) job SID6063614584776672 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 03:56
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 03:56
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 00:34
Unable to retrieve "2qpxA00" HMM(SAM) results for job "SID2427829654814624"
Flow stage update by auto on 03 Mar 2009 23:24
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 03 Mar 2009 23:24
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 15:47
Unable to retrieve "2qpxA00" HMM(SAM) results for job "SID4584228384247744"
Sam cath submit by auto on 19 Feb 2009 15:17
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 15:17
The entry "2qpxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 12:27
Retrieved "2qpxA00" CATHEDRAL results for job ID SID3251425520831504 and inserted them into the database.
Domain scan cathedral cath by auto on 19 Feb 2009 12:27
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 143 results for 2qpxA00
Update comment by auto on 19 Feb 2009 07:11
"2qpxA00" CATHEDRAL job SID3251425520831504 is not yet finished.
Flow stage update by auto on 19 Feb 2009 06:17
The entry "2qpxA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 19 Feb 2009 06:17
The entry "2qpxA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2009 11:54
Unable to retrieve "2qpxA00" CATHEDRAL results for job "SID5476278865808656"
Update comment by auto on 22 Jan 2009 17:05
"2qpxA00" CATHEDRAL job SID5476278865808656 is not yet finished.
Cathedral cath submit by auto on 22 Jan 2009 16:27
The entry "2qpxA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Jan 2009 16:27
The entry "2qpxA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 21 Dec 2008 14:49
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qpxA00.scanlist" for "2qpxA00"
Write scan list by auto on 21 Dec 2008 14:49
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qpxA00.scanlist" for domain "2qpxA00"
Update comment by auto on 21 Dec 2008 11:52
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 20:41
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 19:04
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 14:35
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 11:35
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 07:49
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 03:58
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 00:49
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 20:42
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 16:55
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 11:34
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 23:33
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 22:12
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 17:38
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 14:52
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 11:32
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 09:47
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 04:24
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 00:27
Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 20:35
Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 18:32
Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 14:43
Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 10:54
Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 20:40
Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 17:13
Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 20:41
Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 17:18
Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 20:37
Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 16:50
Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Dec 2008 20:55
Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Flow stage update by auto on 12 Dec 2008 20:52
No satisfactory AssignClose result found.
Flow stage update by auto on 12 Dec 2008 20:36
No in_process hits for Domain "2qpxA00" ready to be processed
Flow stage update by auto on 12 Dec 2008 20:35
NW result present for Domain "2qpxA00"
Flow stage update by auto on 10 Dec 2008 14:15
All required files are present for Domain "2qpxA00"
Flow stage update by auto on 10 Dec 2008 14:14
Beginning processing for Domain "2qpxA00"
Insertion by cuff on 08 Dec 2008 12:31
nice chopping
