CATH Domain: 2qp8A01 XML data for domain: 2qp8A01

Molscript image for 2qp8A01
2qp8A01
PDB coordinates for domain 2qp8A01

PDB 2qp8, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.70 Cathepsin D, subunit A; domain 1
2.40.70.10 Acid Proteases Gene3D
2.40.70.10.2
2.40.70.10.2.1
2.40.70.10.2.1.1
2.40.70.10.2.1.1.1
2.40.70.10.2.1.1.1.1

[top]
Segment boundaries for domain 2qp8A01

Chopping figure for domain 2qp8A01
DomainStart PDB ResidueStop PDB Residue
2qp8A01 75 207
2qp8A02 208 447

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 2.40.70.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3psgA01 85.52 Sus scrofaPepsin A 2.40.70.10 165 27 77 1.79 2.31
1j71A01 84.60 Candida tropicalisCandidapepsin 2.40.70.10 173 21 71 1.42 2.00
1mppA01 84.26 Rhizomucor pusillusMucorpepsin 2.40.70.10 181 22 71 1.76 2.45
1pfzB01 84.09 Plasmepsin II [EC:3.4.23.39]Plasmepsin-2Plasmodium falciparum 2.40.70.10 155 22 77 1.71 2.21
1bxoA01 83.44 PenicillopepsinPenicillium janthinellum 2.40.70.10 165 24 76 2.31 3.00
1wkrA01 83.05 Irpex lacteusPolyporopepsin 2.40.70.10 170 28 69 1.69 2.43
1lyaA00 81.19 LysosomeAspartic-type endopeptidase activityCathepsin D [EC:3.4.23.5]Homo sapiensCathepsin D 2.40.70.10 97 28 57 1.92 3.32
2hahA00 80.35 Pol polyproteinFeline immunodeficiency virus (isolate Petaluma) 2.40.70.10 112 11 75 3.68 4.89
1b5fC00 77.92 Preprocardosin ACynara cardunculus 2.40.70.10 238 25 52 2.03 3.90
1t6eX01 74.61 Triticum aestivumXylanase inhibitor 2.40.70.10 174 9 59 2.92 4.89
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qp8A01
YYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNV
TVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qp8A01
YYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNV
TVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHV
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 15 Mar 2008 20:36

Assigning to "2.40.70.10" based on similarity with "2va6A01"

Flow stage update by auto on 15 Mar 2008 20:36

No in_process hits for Domain "2qp8A01" ready to be processed

Update comment by auto on 15 Mar 2008 20:34

Domain "2qp8A01" hits Domain "2qp8B01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 20:31

Domain "2qp8A01" hits Domain "2qmdA01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 20:29

Domain "2qp8A01" hits Domain "2qmfB01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 20:26

Domain "2qp8A01" hits Domain "2qmdB01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 20:23

Domain "2qp8A01" hits Domain "2qmfA01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 20:20

Domain "2qp8A01" hits Domain "2qk5B01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 20:15

Domain "2qp8A01" hits Domain "3braA01" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2008 14:17

Domain "2qp8A01" hits Domain "2qk5A01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Mar 2008 14:05

Domain "2qp8A01" hits Domain "2qk5A01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Mar 2008 14:05

NW result present for Domain "2qp8A01"

Flow stage update by auto on 15 Mar 2008 08:07

All required files are present for Domain "2qp8A01"

Flow stage update by auto on 14 Mar 2008 14:42

Beginning processing for Domain "2qp8A01"

Insertion by auto on 14 Mar 2008 14:28

Final ChopClose added based on similarity with "2qk5A"