CATH Domain: 2qorA02 XML data for domain: 2qorA02

Molscript image for 2qorA02
2qorA02
PDB coordinates for domain 2qorA02

PDB 2qor, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.63 Guanylate Kinase phosphate binding domain
3.30.63.10 Guanylate Kinase phosphate binding domain Gene3D
3.30.63.10.2
3.30.63.10.2.1
3.30.63.10.2.1.1
3.30.63.10.2.1.1.1
3.30.63.10.2.1.1.1.1

[top]
Segment boundaries for domain 2qorA02

Chopping figure for domain 2qorA02
DomainStart PDB ResidueStop PDB Residue
2qorA01 2 35
2qorA01 96 191
2qorA02 36 95

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.63.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ex7A01 95.75 CytoplasmIdentical protein bindingPurine metabolismNucleusGuanylate kinase [EC:2.7.4.8] 3.30.63.10 60 35 100 0.79 0.79
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qorA02
ISCTTRNKREKETNGVDYYFVDKDDFERKLKEGQFLEFDKYANNFYGTLKSEYDLAVGEG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qorA02
ISCTTRNKREKETNGVDYYFVDKDDFERKLKEGQFLEFDKYANNFYGTLKSEYDLAVGEG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 29 Nov 2007 10:33

Assigning to "3.30.63.10" based on similarity with "1z6gA02"

Flow stage update by auto on 29 Nov 2007 10:15

No in_process hits for Domain "2qorA02" ready to be processed

Flow stage update by auto on 29 Nov 2007 10:15

NW result present for Domain "2qorA02"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2qorA02"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2qorA02"

Insertion by auto on 23 Nov 2007 11:53

Final ChopClose added based on similarity with "1z6gA"