CATH Domain: 2qolA01 XML data for domain: 2qolA01

Molscript image for 2qolA01
2qolA01
PDB coordinates for domain 2qolA01

PDB 2qol, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.200 Phosphorylase Kinase; domain 1
3.30.200.20 Phosphorylase Kinase; domain 1 Gene3D
3.30.200.20.1
3.30.200.20.1.1
3.30.200.20.1.1.1
3.30.200.20.1.1.1.1
3.30.200.20.1.1.1.1.1

[top]
Segment boundaries for domain 2qolA01

Chopping figure for domain 2qolA01
DomainStart PDB ResidueStop PDB Residue
2qolA01 595 701
2qolA02 702 904

Structural Neighbourhood (41 entries)

There are 41 matching structural neighberhood comparisons for CATH ID 3.30.200.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 41 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bu3A01 88.44 Insulin receptorInsulin receptor complexPositive regulation of nitric oxide biosynthetic processPhosphoinositide 3-kinase bindingPositive regulation of respiratory burst 3.30.200.20 92 29 86 2.49 2.86
1xbbA01 87.49 T cell receptor complexTyrosine-protein kinase SYKOrgan morphogenesisLeukocyte cell-cell adhesionCell proliferation 3.30.200.20 83 27 85 1.69 1.97
3eqrB01 86.20 Activated CDC42 kinase 1GTPase inhibitor activitySmall GTPase mediated signal transductionHomo sapiensPositive regulation of peptidyl-tyrosine phosphorylation 3.30.200.20 91 35 86 2.26 2.60
1lufA01 85.79 Muscle, skeletal receptor tyrosine protein kinaseReceptor clusteringRattus norvegicusResponse to muscle activityMemory 3.30.200.20 97 32 84 2.22 2.63
3bceA01 84.79 Receptor tyrosine-protein kinase erbB-4Transmembrane receptor protein tyrosine kinase activityHomo sapiensBasolateral plasma membraneProtein binding 3.30.200.20 94 32 87 2.80 3.21
3c4cA01 84.58 Neurotrophin signaling pathwayNon-small cell lung cancerCytoplasmErbB signaling pathwayProtein phosphorylation 3.30.200.20 86 24 86 2.60 3.02
3comB01 83.93 Transcription factor bindingPathways in cancerNon-small cell lung cancerCytoplasmSerine/threonine-protein kinase 4 3.30.200.20 85 22 88 4.40 4.99
3blhA01 83.56 Transcription elongation from RNA polymerase II promoterCyclin-dependent protein kinase activityRNA polymerase II carboxy-terminal domain kinase activityProtein bindingCell proliferation 3.30.200.20 86 21 87 4.29 4.92
1fmkA03 83.29 Epithelial cell signaling in Helicobacter pylori infectionPositive regulation of integrin activationRegulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcErbB signaling pathway 3.30.200.20 86 30 88 3.52 3.98
2rgpA01 83.28 Calcium signaling pathwayPositive regulation of nitric oxide biosynthetic processEpidermal growth factor receptor activityResponse to UV-APositive regulation of cyclin-dependent protein kinase activity involved in G1/S 3.30.200.20 82 28 89 3.87 4.33
3hmmA01 83.25 Type II transforming growth factor beta receptor bindingPeptidyl-threonine phosphorylationPositive regulation of cellular component movementPathway-restricted SMAD protein phosphorylationResponse to cholesterol 3.30.200.20 84 20 82 2.50 3.04
2rkuA01 82.80 Polo-like kinase 1 [EC:2.7.11.21]Polo kinase kinase activityProgesterone-mediated oocyte maturationCell proliferationOocyte meiosis 3.30.200.20 89 15 86 2.87 3.32
2acxA02 82.52 G protein-coupled receptor kinase 6Homo sapiensRegulation of G-protein coupled receptor protein signaling pathway 3.30.200.20 91 16 84 2.80 3.31
3e64A01 82.39 Jak-STAT signaling pathwayCellular component movementTyrosine-protein kinase JAK2Chemokine signaling pathwayAdipocytokine signaling pathway 3.30.200.20 93 23 86 3.78 4.39
1fvrA01 81.99 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 86 21 89 3.54 3.95
1ob3A01 81.78 Cyclin-dependent kinase [EC:2.7.11.22]Cell division control protein 2 homologPlasmodium falciparum K1 3.30.200.20 83 15 89 4.28 4.79
2clqA01 81.69 Induction of apoptosis by extracellular signalsProtein homodimerization activityMitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]Neurotrophin signaling pathwayATP binding 3.30.200.20 85 16 83 2.66 3.18
2r3iA01 81.53 Progesterone-mediated oocyte maturationPathways in cancerSmall cell lung cancerOocyte meiosisProstate cancer 3.30.200.20 76 17 83 3.85 4.61
2j51A01 81.43 CytoplasmOocyte meiosisSTE20-like serine/threonine-protein kinasePlasma membraneHomo sapiens 3.30.200.20 90 21 88 3.24 3.65
3bqcA02 81.30 Protein N-terminus bindingCasein kinase II subunit alphaSin3 complexCasein kinase 2, alpha polypeptide [EC:2.7.11.1]Plasma membrane 3.30.200.20 91 20 90 4.11 4.56
1x8bA01 81.25 Homo sapiensWee1-like protein kinaseProtein binding 3.30.200.20 84 16 84 3.61 4.26
2oibA01 81.05 Chagas diseaseNeurotrophin signaling pathwayInterleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]ApoptosisHomo sapiens 3.30.200.20 93 20 78 3.11 3.96
2vgpB01 80.75 Serine/threonine-protein kinase 12-AHistone H3-S10 phosphorylationChromosome, centromeric regionProtein bindingChromatin 3.30.200.20 89 15 83 3.01 3.62
1s9jA01 80.75 Prion diseasesNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.200.20 86 14 88 3.85 4.36
2dylA01 80.62 Mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]MAP kinase kinase activityNeurotrophin signaling pathwayStress-activated MAPK cascadeT cell receptor signaling pathway 3.30.200.20 91 10 80 3.35 4.18
1uu3A02 80.54 PPAR signaling pathway3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]Peptidyl-threonine phosphorylationAldosterone-regulated sodium reabsorptionNon-small cell lung cancer 3.30.200.20 93 16 84 3.45 4.06
3c0iA01 80.19 Actin cytoskeletonGuanylate kinase activityPeripheral plasma membrane protein CASKCell adhesionHomo sapiens 3.30.200.20 88 15 84 3.50 4.16
2evaA01 79.62 Positive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionMitogen-activated protein kinase kinase kinase 7Protein binding 3.30.200.20 82 21 82 3.37 4.09
2qkwB01 79.35 Solanum pimpinellifoliumProtein kinaseProtein binding 3.30.200.20 72 18 78 3.43 4.35
2ac3A01 78.96 MAP kinase-interacting serine/threonine-protein kinase 2ATP bindingProtein phosphorylationHomo sapiensProtein serine/threonine kinase activity 3.30.200.20 80 11 81 3.32 4.09
2jamA01 78.95 Calcium/calmodulin-dependent protein kinase type 1GHomo sapiensCalcium/calmodulin-dependent protein kinase I [EC:2.7.11.17] 3.30.200.20 75 17 82 3.64 4.42
3g0eA01 78.90 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Protein bindingAcute myeloid leukemia 3.30.200.20 131 28 64 2.97 4.58
2w5aA01 78.69 NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]Regulation of mitosisSerine/threonine-protein kinase Nek2CentrosomeCentrosome separation 3.30.200.20 64 18 65 2.72 4.13
1ckiA01 78.59 SpindleRattus norvegicusHedgehog signaling pathwaySoluble fractionCircadian rhythm - mammal 3.30.200.20 64 17 69 2.84 4.09
1zy4A01 78.32 Eukaryotic translation initiation factor 2alpha kinase activityProtein bindingSerine/threonine-protein kinase GCN2DNA damage checkpointRegulation of translational initiation 3.30.200.20 94 18 77 3.07 3.95
1xwsA01 77.50 Transcription factor bindingPositive regulation of cyclin-dependent protein kinase activity involved in G1/SManganese ion bindingNegative regulation of apoptosisProtein binding 3.30.200.20 92 16 78 3.17 4.05
1omwA03 76.00 MembraneG-protein coupled receptor kinase activityNegative regulation of the force of heart contraction by chemical signalChemokine signaling pathwayMuscarinic acetylcholine receptor signaling pathway 3.30.200.20 107 10 67 2.52 3.75
3fhrA01 75.71 Response to stressMAP kinase kinase activityNucleusMitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]MAPK signaling pathway 3.30.200.20 80 11 82 4.04 4.91
1o6lA02 75.02 Jak-STAT signaling pathwayRAC-beta serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.200.20 117 16 64 2.72 4.19
1kutB01 74.83 Thermotoga maritimaPhosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Metabolic pathways 3.30.200.20 88 9 65 3.24 4.92
1rdqE02 74.55 Calcium signaling pathwayPrion diseasesProtein kinase A [EC:2.7.11.11]Olfactory transductionMesoderm formation 3.30.200.20 124 17 62 2.96 4.71
[1]
Displaying entries 1 to 41 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qolA01
TFVVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRL
EGVVTKSKPVMIVTEY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qolA01
TFVDPHTFEDPTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIM
GQFDHPNIIRLEGVVTKSKPVMIVTEY
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 27 Apr 2009 21:35

Assigning to "3.30.200.20" based on similarity with "2qooA01"

Flow stage update by auto on 27 Apr 2009 21:33

No in_process hits for Domain "2qolA01" ready to be processed

Update comment by auto on 27 Apr 2009 21:29

Domain "2qolA01" hits Domain "2qokA01" (100% over 100%) which is currently in process

Update comment by auto on 27 Apr 2009 21:14

Domain "2qolA01" hits Domain "2qoqA01" (98.1132075471698% over 99.0654205607477%) which is currently in process

Update comment by auto on 27 Apr 2009 20:59

Domain "2qolA01" hits Domain "2qooA01" (100% over 100%) which is currently in process

Update comment by auto on 27 Apr 2009 20:41

Domain "2qolA01" hits Domain "2qonA01" (100% over 99.0654205607477%) which is currently in process

Update comment by auto on 27 Apr 2009 20:20

Domain "2qolA01" hits Domain "2reiA01" (74.7663551401869% over 100%) which is currently in process

Update comment by auto on 27 Apr 2009 17:11

Domain "2qolA01" hits Domain "2qoiA01" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Apr 2009 17:10

Domain "2qolA01" hits Domain "2qoiA01" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Apr 2009 17:10

NW result present for Domain "2qolA01"

Flow stage update by auto on 20 Apr 2009 08:14

All required files are present for Domain "2qolA01"

Flow stage update by auto on 01 Apr 2009 09:36

Beginning processing for Domain "2qolA01"

Insertion by auto on 31 Mar 2009 22:26

Final ChopClose added based on similarity with "2gsfA"