CATH Domain: 2qntA01 XML data for domain: 2qntA01

Molscript image for 2qntA01
2qntA01
PDB coordinates for domain 2qntA01

PDB 2qnt, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.180 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.10 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 Gene3D
3.10.180.10.15
3.10.180.10.15.1
3.10.180.10.15.1.1
3.10.180.10.15.1.1.1
3.10.180.10.15.1.1.1.1

[top]
Segment boundaries for domain 2qntA01

Chopping figure for domain 2qntA01
DomainStart PDB ResidueStop PDB Residue
2qntA01 5 122

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.10.180.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3huhA01 84.22 Virulence protein STM3117Salmonella enterica subsp. enterica serovar Typhimurium 3.10.180.10 119 17 88 3.30 3.74
3ghjA00 84.21 Uncultured bacteriumPutative integron gene cassette protein 3.10.180.10 114 17 84 2.55 3.03
2rbbA00 84.18 Burkholderia phytofirmans PsJNGlyoxalase/bleomycin resistance protein/dioxygenase 3.10.180.10 126 20 85 2.52 2.94
2i7rA00 83.64 Conserved domain proteinStreptococcus pneumoniae 3.10.180.10 112 12 89 2.73 3.06
2p25A01 82.72 Glyoxylase I family proteinGlyoxylase family proteinEnterococcus faecalis 3.10.180.10 118 15 80 2.59 3.22
2qqzA01 82.61 Bacillus anthracisGlyoxalase family protein 3.10.180.10 113 15 84 2.55 3.00
1ecsA00 82.16 Klebsiella pneumoniaeBleomycin resistance protein 3.10.180.10 120 17 83 2.92 3.50
2rk0A01 82.12 Glyoxalase/bleomycin resistance protein/dioxygenaseFrankia sp. EAN1pec 3.10.180.10 119 19 82 3.31 4.02
3ct8A00 81.97 BH2160 proteinBacillus halodurans 3.10.180.10 131 14 77 2.42 3.14
1u6lA01 75.59 Pseudomonas aeruginosaPhnB proteinPutative uncharacterized protein 3.10.180.10 120 9 80 3.14 3.88
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qntA01
NPIPFVRDINRSKSFYRDRLGLKILEDFGSFVLFETGFAIHEGRSLEETIWRTSSQEAYGRRNLLYFEHADVDAAFQDIA
PHVELIHPLERQAWGQRVFRFYDPDGHAIEVGESL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qntA01
NPIPFVRDINRSKSFYRDRLGLKILEDFGSFVLFETGFAIHEGRSLEETIWRTSSDAQEAYGRRNXLLYFEHADVDAAFQ
DIAPHVELIHPLERQAWGQRVFRFYDPDGHAIEVGESLSQSGENLYFQGGS
BLAST against CATH

[top]
Domain History Events (83)

Domain assigned by cuff on 18 Mar 2009 13:32

same superfamily

Domain assignment manual match h by cuff on 18 Mar 2009 13:29

homology match

Homcheck allotment by cuff on 18 Mar 2009 13:22

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 18 Mar 2009 13:22

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Mar 2009 06:18

Domain "2qntA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 16 Mar 2009 06:18

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qntA01

Flow stage update by auto on 16 Mar 2009 02:48

Retrieved PRC_PFAMCATH results for job ID SID7500955738466272 and results inserted.

Domain scan prc pfamcath by auto on 16 Mar 2009 02:48

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 51 results for 2qntA01

Update comment by auto on 13 Mar 2009 22:26

PRC_PFAMCATH job SID7500955738466272 is not yet finished.

Prc pfamcath submit by auto on 13 Mar 2009 22:22

The entry "2qntA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 13 Mar 2009 22:22

The entry "2qntA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 13 Mar 2009 22:09

Retrieved SSAP results for job ID SID8513075526774320 and results inserted.

Domain scan ssap cath by auto on 13 Mar 2009 22:08

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 618 results for 2qntA01

Update comment by auto on 10 Mar 2009 02:30

SSAP job SID8513075526774320 is not yet finished.

Ssap cath submit by auto on 10 Mar 2009 02:16

The entry "2qntA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 02:16

The entry "2qntA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 01:12

Retrieved PRC results for job ID SID6338801180692416 and inserted them into the database.

Domain scan prc cath by auto on 10 Mar 2009 01:11

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 41 results for 2qntA01

Update comment by auto on 09 Mar 2009 19:55

PRC job SID6338801180692416 is not yet finished.

Flow stage update by auto on 09 Mar 2009 19:36

The entry "2qntA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Mar 2009 19:36

The entry "2qntA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 18:36

Retrieved HMM(SAM) results for job ID SID3865406943744178 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 18:36

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 30 results for 2qntA01

Update comment by auto on 04 Mar 2009 16:07

HMM(SAM) job SID3865406943744178 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 15:55

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 15:55

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:34

Unable to retrieve "2qntA01" HMM(SAM) results for job "SID3195283419783488"

Update comment by auto on 04 Mar 2009 04:09

HMM(SAM) job SID3195283419783488 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 03:56

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 03:56

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:33

Unable to retrieve "2qntA01" HMM(SAM) results for job "SID5731790491677440"

Sam cath submit by auto on 03 Mar 2009 23:24

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:24

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:46

Unable to retrieve "2qntA01" HMM(SAM) results for job "SID8414807587354816"

Update comment by auto on 19 Feb 2009 08:29

HMM(SAM) job SID8414807587354816 is not yet finished.

Flow stage update by auto on 19 Feb 2009 08:00

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 19 Feb 2009 08:00

The entry "2qntA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 07:11

Retrieved "2qntA01" CATHEDRAL results for job ID SID7293714709021552 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 07:10

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 20 results for 2qntA01

Cathedral cath submit by auto on 19 Feb 2009 06:17

The entry "2qntA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 19 Feb 2009 06:17

The entry "2qntA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 11:54

Unable to retrieve "2qntA01" CATHEDRAL results for job "SID0841931135318196"

Update comment by auto on 22 Jan 2009 17:05

"2qntA01" CATHEDRAL job SID0841931135318196 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:26

The entry "2qntA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:26

The entry "2qntA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 14:49

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qntA01.scanlist" for "2qntA01"

Write scan list by auto on 21 Dec 2008 14:49

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qntA01.scanlist" for domain "2qntA01"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:41

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:35

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:35

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:49

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:58

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:49

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:42

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:55

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:34

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:33

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:47

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:24

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:27

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:35

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:54

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:13

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:41

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:18

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:37

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 16:50

Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 20:55

Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Flow stage update by auto on 12 Dec 2008 20:52

No satisfactory AssignClose result found.

Flow stage update by auto on 12 Dec 2008 20:36

No in_process hits for Domain "2qntA01" ready to be processed

Flow stage update by auto on 12 Dec 2008 20:35

NW result present for Domain "2qntA01"

Flow stage update by auto on 10 Dec 2008 14:15

All required files are present for Domain "2qntA01"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2qntA01"

Insertion by cuff on 08 Dec 2008 12:31

nice chopping