CATH Domain: 2qniA01

2qniA01

PDB 2qni, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.50	Rossmann fold
3.40.50.1240	Phosphoglycerate mutase-like	Gene3D
3.40.50.1240.7
3.40.50.1240.7.1
3.40.50.1240.7.1.1
3.40.50.1240.7.1.1.1
3.40.50.1240.7.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qniA01

Domain	Start PDB Residue	Stop PDB Residue
2qniA01	21	213

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.1240.7.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1ujcA00	81.85	CytoplasmPhosphohistidine phosphatase activityPhosphohistidine phosphatase [EC:3.1.3.-]Phosphohistidine phosphatase sixAProtein modification process	3.40.50.1240	156	9	78	2.80	3.55
	2rflH00	79.46	Agrobacterium tumefaciens str. C58Putative uncharacterized protein	3.40.50.1240	152	12	74	3.70	5.00

[top]
Domain ATOM Sequence

>pdb|2qniA01
GHALYITHPQVKIDPAVPVPEWGLSERGAERAREASRLPWAKALRRIVSSAETKAIETAHLAETSGAAIEIIEAHENDRS
ATGFLPPPEFEKAADWFFAHPEESFQGWERAIDAQARIVEAVKAVLDRHDARQPIAFVGHGGVGTLLKCHIEGRGISRSQ
PAGGGNLFRFSIAEFSAAATCDWTA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qniA01
XGSSHHHHHHSSGRENLYFQGXHALYITHPQVKIDPAVPVPEWGLSERGAERAREASRLPWAKALRRIVSSAETKAIETA
HXLAETSGAAIEIIEAXHENDRSATGFLPPPEFEKAADWFFAHPEESFQGWERAIDAQARIVEAVKAVLDRHDARQPIAF
VGHGGVGTLLKCHIEGRGISRSKDQPAGGGNLFRFSIAEFSLAAASPTCDWTA

BLAST against CATH

[top]
Domain History Events (73)

Domain assigned by cuff on 06 Jan 2009 16:48

same superfamily

Domain assignment manual match h by cuff on 06 Jan 2009 16:46

homology match

Homcheck allotment by cuff on 06 Jan 2009 16:45

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 16:45

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Oct 2008 21:51

Domain "2qniA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Oct 2008 21:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qniA01

Flow stage update by auto on 15 Oct 2008 21:32

Retrieved PRC_PFAMCATH results for job ID SID6530853050618848 and results inserted.

Domain scan prc pfamcath by auto on 15 Oct 2008 21:32

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 8 results for 2qniA01

Update comment by auto on 15 Oct 2008 15:12

PRC_PFAMCATH job SID6530853050618848 is not yet finished.

Prc pfamcath submit by auto on 15 Oct 2008 15:08

The entry "2qniA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Oct 2008 15:08

The entry "2qniA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Oct 2008 14:52

Retrieved SSAP results for job ID SID7417924221464320 and results inserted.

Domain scan ssap cath by auto on 15 Oct 2008 14:49

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 971 results for 2qniA01

Update comment by auto on 10 Oct 2008 03:28

SSAP job SID7417924221464320 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:48

The entry "2qniA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:48

The entry "2qniA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 00:05

Retrieved PRC results for job ID SID1020576877075356 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 00:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2qniA01

Update comment by auto on 08 Oct 2008 15:23

PRC job SID1020576877075356 is not yet finished.

Flow stage update by auto on 08 Oct 2008 15:14

The entry "2qniA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 15:14

The entry "2qniA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 14:51

Retrieved HMM(SAM) results for job ID SID9849741415874468 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 14:50

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 2qniA01