CATH Domain: 2qmoA00

2qmoA00

PDB 2qmo, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.50	Rossmann fold
3.40.50.300	P-loop containing nucleotide triphosphate hydrolases	Gene3D
3.40.50.300.9
3.40.50.300.9.1
3.40.50.300.9.1.1
3.40.50.300.9.1.1.1
3.40.50.300.9.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qmoA00

Domain	Start PDB Residue	Stop PDB Residue
2qmoA00	-1	218

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.300.9.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2obnA02	75.29	Anabaena variabilis ATCC 29413Putative uncharacterized protein	3.40.50.300	208	10	75	3.53	4.65
	1g3qA00	75.15	Pyrococcus furiosusCell division inhibitor minD homologSeptum site-determining protein MinD	3.40.50.300	237	11	76	3.83	4.99

[top]
Domain ATOM Sequence

>pdb|2qmoA00
GHLFISATNTNAGKTTCARLLAQYCNACGVKTILLKPIETGVNDAINHSSDAHLFLQDNRLLDRSLTLKDISFYRYHKVS
APLIAQQEEDPNAPIDTDNLTQRLHNFTKTYDLVIVEGAGGLCVPITLEENLDFALKLKAKLLISHDNLGLINDCLLNDF
LLKSHQLDYKIAINLKGNNTAFHSISLPYIELFNTRSNNPIVIFQQSLKVLSFALK

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qmoA00
GHXLFISATNTNAGKTTCARLLAQYCNACGVKTILLKPIETGVNDAINHSSDAHLFLQDNRLLDRSLTLKDISFYRYHKV
SAPLIAQQEEDPNAPIDTDNLTQRLHNFTKTYDLVIVEGAGGLCVPITLEENXLDFALKLKAKXLLISHDNLGLINDCLL
NDFLLKSHQLDYKIAINLKGNNTAFHSISLPYIELFNTRSNNPIVIFQQSLKVLXSFALK

BLAST against CATH

[top]
Domain History Events (73)

Domain assigned by cuff on 06 Jan 2009 15:54

same superfamily

Domain assignment manual match h by cuff on 06 Jan 2009 15:51

homology match

Homcheck allotment by cuff on 06 Jan 2009 15:50

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 15:50

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Oct 2008 21:47

Domain "2qmoA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Oct 2008 21:47

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qmoA00

Flow stage update by auto on 15 Oct 2008 21:27

Retrieved PRC_PFAMCATH results for job ID SID0394350251679008 and results inserted.

Domain scan prc pfamcath by auto on 15 Oct 2008 21:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 438 results for 2qmoA00

Update comment by auto on 15 Oct 2008 09:07

PRC_PFAMCATH job SID0394350251679008 is not yet finished.

Flow stage update by auto on 15 Oct 2008 08:58

The entry "2qmoA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Oct 2008 08:58

The entry "2qmoA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Oct 2008 08:42

Retrieved SSAP results for job ID SID9019391477541968 and results inserted.

Domain scan ssap cath by auto on 15 Oct 2008 08:39

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1371 results for 2qmoA00

Update comment by auto on 10 Oct 2008 03:27

SSAP job SID9019391477541968 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:47

The entry "2qmoA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:47

The entry "2qmoA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Oct 2008 23:59

Retrieved PRC results for job ID SID1139836668301864 and inserted them into the database.

Domain scan prc cath by auto on 09 Oct 2008 23:59

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2qmoA00

Update comment by auto on 08 Oct 2008 15:22

PRC job SID1139836668301864 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 15:13

The entry "2qmoA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 15:13

The entry "2qmoA00" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 14:47

Retrieved HMM(SAM) results for job ID SID9717896011106752 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 14:47

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2qmoA00