CATH Domain: 2qmmA00 XML data for domain: 2qmmA00

Molscript image for 2qmmA00
2qmmA00
PDB coordinates for domain 2qmmA00

PDB 2qmm, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.12
3.40.1280.10.12.1
3.40.1280.10.12.1.1
3.40.1280.10.12.1.1.1
3.40.1280.10.12.1.1.1.1

[top]
Segment boundaries for domain 2qmmA00

Chopping figure for domain 2qmmA00
DomainStart PDB ResidueStop PDB Residue
2qmmA00 94 288

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qwvA00 88.37 Vibrio choleraeUPF0217 protein VC_A1059 3.40.1280.10 180 27 89 1.88 2.09
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qmmA00
AVRGFLIVGNKAFTQPFSLNDLPGAGRMDVLCRCTSQALFISHGIRRDVEVYLLLLGPPSPPKSILIKGDEVRRMSPDER
NVAGHIKKALAVECGKSWKKVHSGVYVSRKGLEELIEELSEKYSIIYLKEDGVDISNAQLPPNPLFVIGDHEGLTEEQEK
VVERYAALKLSLSPLSLLAEQCVVIAHHHLDRLQF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qmmA00
SNAVRGFLIVGNKAFTQPFSLNDLPGAGRMDVLCRCTSQALFISHGIRRDVEVYLLLLGPPSPPKSILIKGDEVRRMSPD
ERNVAGHIKKALAVECGKSWKKVHSGVYVSRKGLEELIEELSEKYSIIYLKEDGVDISNAQLPPNPLFVIGDHEGLTEEQ
EKVVERYAALKLSLSPLSLLAEQCVVIAHHHLDRLQF
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 06 Jan 2009 15:52

Assigning to "3.40.1280.10" based on similarity with "2qmmB00"

Flow stage update by auto on 06 Jan 2009 15:49

No in_process hits for Domain "2qmmA00" ready to be processed

Update comment by auto on 14 Sep 2008 17:14

Domain "2qmmA00" hits Domain "2qmmB00" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 17:11

Domain "2qmmA00" hits Domain "2qmmB00" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qmmA00"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qmmA00"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qmmA00"

Insertion by cuff on 10 Sep 2008 12:15

nice chopping