CATH Domain: 2qmaA02 XML data for domain: 2qmaA02

Molscript image for 2qmaA02
2qmaA02
PDB coordinates for domain 2qmaA02

PDB 2qma, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.21
3.90.1150.10.21.1
3.90.1150.10.21.1.1
3.90.1150.10.21.1.1.1
3.90.1150.10.21.1.1.1.1

[top]
Segment boundaries for domain 2qmaA02

Chopping figure for domain 2qmaA02
DomainStart PDB ResidueStop PDB Residue
2qmaA01 475 560
2qmaA02 561 573
2qmaA02 846 957
2qmaA03 575 844

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3k40A03 84.74 Aromatic-L-amino-acid decarboxylase activityDopamine biosynthetic process from tyrosineAromatic-L-amino-acid decarboxylaseDevelopmental pigmentationSerotonin biosynthetic process from tryptophan 3.90.1150.10 99 22 76 2.05 2.69
1p3wA01 80.55 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.90.1150.10 121 8 82 3.02 3.65
1uu2B01 80.32 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 8 83 3.20 3.83
1jg8A02 80.08 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 12 76 3.10 4.07
1uu1B01 79.66 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 131 8 77 3.20 4.11
1d2fB01 78.99 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 7 87 3.94 4.52
1m32A01 78.95 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 11 86 3.11 3.58
1eg5B01 77.83 Thermotoga maritimaThiamine metabolismCysteine desulfurase [EC:2.8.1.7]Aminotransferase, class V 3.90.1150.10 106 7 77 3.07 3.98
1iugA01 77.43 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 9 84 3.57 4.23
3ftbA01 76.56 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathwaysPhenylalanine metabolism 3.90.1150.10 112 11 87 3.46 3.95
1djuB01 76.53 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Pyrococcus horikoshiiMetabolic pathways 3.90.1150.10 143 6 77 3.67 4.73
1ohvA01 76.02 Sus scrofaMitochondrial matrixSuccinate-semialdehyde dehydrogenase bindingProtein homodimerization activityPyridoxal phosphate binding 3.90.1150.10 166 7 62 3.03 4.88
1xi9B01 75.78 Pyrococcus furiosusAminotransferase [EC:2.6.1.-]Alanine aminotransferase 3.90.1150.10 144 8 81 4.04 4.97
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qmaA02
HPDCIAHLHTPPLQNVGPKALGDYDHLLAQTLEVADIRTNDQFELLAEPSLSTVLFRATHETADLDELNKALRLEALTRG
IAVLGETIVDGKTALKFTILNPCLTTSDFESLLSKINLAVEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qmaA02
HPDCIAHLHTPPLQNVGPKALGDXYDHLLAQTLEVADXIRTNDQFELLAEPSLSTVLFRATHETADLDELNKALRLEALT
RGIAVLGETIVDGKTALKFTILNPCLTTSDFESLLSKINXLAVELV
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 16 Mar 2009 20:41

Assigning to "3.90.1150.10" based on similarity with "2qmaB02"

Flow stage update by auto on 16 Mar 2009 20:24

No in_process hits for Domain "2qmaA02" ready to be processed

Update comment by auto on 12 Dec 2008 20:38

Domain "2qmaA02" hits Domain "2qmaB02" (97.6190476190476% over 100%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:36

Domain "2qmaA02" hits Domain "2qmaB02" (97.6190476190476% over 100%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:35

NW result present for Domain "2qmaA02"

Flow stage update by auto on 10 Dec 2008 14:15

All required files are present for Domain "2qmaA02"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2qmaA02"

Insertion by auto on 08 Dec 2008 14:09

Final ChopClose added based on similarity with "2qmaB"